Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR109 IGR102 IGR105 IGR106 IGR107 IGR108 IGR104 adk, - CT128 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 rpe,araD, - CT121 glnQ, - CT130 accC, - CT124 adk, - CT128 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 rpe,araD, - CT121 glnQ, - CT130 accC, - CT124 adk, - CT128 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 accC, - CT124 efp1, - CT122 rpe,araD, - CT121 efp1, - CT122
* Calculated from Protein Sequence

Gene ID: CT128

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
adk  

Definition:
adenylate kinase

Gene Start:
144093

Gene Stop:
143359

Gene Length:
735

Molecular Weight*:
27770

pI*:
4.61

Net Charge*:
-10.65

EC:
2.7.4.3  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; purines  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism

Comment:
Converts AMP (or dAMP) to ADP (or dADP).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to adenylate kinase proteins, e.g., 34% similarity to KAD_BACSU, 31% similarity to KAD_BACST.
CT128 is similar to TP0595 in T.pallidum and to MG171 in M.genitalium,
both predicted adenylate kinases.

CT128 is orthologously related to CPn0244: residues 9-222 are 45% similar to CPn0244.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0563
COG name: Adenylate kinase/yeast uridylate kinase
Functional Class:  F
The phylogenetic pattern of COG0563 is a--kYqvCebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 9-41, 98-115, 170-203 are significantly matched to blocks BL00113A,B,C, concerned with Adenylate kinase proteins, e.g., KAD_GIALA and KAD1_SCHPO.
Residues 157-173, 1-21 are significantly matched to blocks PR00493A,B, concerned with breast cancer type I susceptibility proteins, e.g., MMU31625.

ProDom Summary:  Protein Domain Search
Residues 8-121 are 39% similar to a kinase domain as observed in KAD_BACSU. Residues 169-199 are consistent with this observation.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 10 to 204 (E-value = 4.2e-46) place CT128 in the ADK family which is described as Adenylate kinase (PF00406)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
99

PDB Hit:
gi|2392647|pdb|1ZIN| Adenylate Kinase With Bound Ap5a Phosphotransferase, Zinc Finger Mol_id: 1; Molecule: Adenylate Kinase; Chain: Null; Synonym: Adk; Ec: 2.7.4.3; Other_details: Zinc Finger

Gene Protein Sequence:
MDRSPLFLIIMGAPGSGKGTQSKLLASQLSLLHISSGDLLRDAVSKDTPL
SQEIKSYLDQGKLLPDTLVWKLVHEKLDEFQQDTLLRRLSFLSRSENSAI
LDGFPRTVTQAKLLHEFLSSYFPNYKVILLDISDEEVLNRLTSRYICPAC
QGIYNEQQGFSSCPKCSVELIRRSDDTLEVILDRIQTYKQETQPVLDYYT
EKQKLITIDANAPTQQVFQSILDSLSASLVYQERDCCNCDCDDED

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCGATCCCCTCTTTTTCTTATTATTATGGGCGCCCCAGGATCCGG
GAAAGGCACCCAGTCAAAGTTACTAGCATCTCAATTATCCCTCCTGCATA
TTAGTTCTGGAGACTTGCTTAGAGATGCGGTTTCCAAAGATACCCCGCTC
AGCCAAGAAATTAAGTCTTATCTAGACCAGGGGAAGTTGCTTCCAGATAC
ATTGGTTTGGAAGTTAGTGCACGAAAAACTAGATGAATTCCAACAGGATA
CGTTATTACGACGACTTTCTTTCCTATCTCGTTCTGAGAACAGTGCTATT
TTAGATGGCTTCCCAAGAACTGTCACCCAAGCGAAGCTTTTACATGAGTT
TCTTAGTTCCTACTTCCCCAATTACAAAGTTATTCTGTTAGACATTTCTG
ATGAAGAAGTTCTTAATCGGTTGACTTCTCGGTATATTTGTCCAGCTTGT
CAAGGCATCTACAATGAACAACAAGGATTTTCTTCCTGCCCTAAATGCTC
TGTAGAACTTATTCGCCGATCAGATGACACTCTAGAAGTGATCCTAGATA
GAATTCAAACGTACAAACAGGAAACTCAACCTGTTCTGGATTATTATACA
GAGAAGCAAAAGCTCATCACTATTGATGCTAATGCTCCCACTCAACAAGT
ATTCCAGAGTATCCTAGATAGCCTTTCTGCTTCTCTTGTCTATCAAGAAA
GAGACTGTTGCAACTGCGATTGCGATGATGAAGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy