Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR109 IGR102 IGR105 IGR106 IGR101 IGR107 IGR108 IGR104 CT120 adk, - CT128 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 rpe,araD, - CT121 accC, - CT124 CT120 adk, - CT128 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 rpe,araD, - CT121 accC, - CT124 CT120 adk, - CT128 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 rpe,araD, - CT121 accC, - CT124 efp1, - CT122 efp1, - CT122
* Calculated from Protein Sequence

Gene ID: CT127

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ydhO  

Definition:
P60-related protein

Gene Start:
143260

Gene Stop:
142412

Gene Length:
849

Molecular Weight*:
31700

pI*:
8.43

Net Charge*:
7.02

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:
Possible member of the invasin repeat family.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to Listeria species p60-related proteins, e.g., 20% similarity to P60_LISMO, 22% similarity to P60_LISWE.
No similarities to T.pallidum or M.genitalium.

CT127 is orthologously related to CPn0245: residues 1-282 of CT127
are 43% similar to residues 1-284 of CPn0245, a predicted P60-related
protein from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0791
COG name: Cell wall-associated hydrolases (invasion-associated proteins)
Functional Class:  M
The phylogenetic pattern of COG0791 is -------cEBRHuj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 257-271 are significantly matched to blocks PR00731D, concerned with cauliflower mosaic virus peptidase, e.g., POL_CAMVC.


ProDom Summary:  Protein Domain Search
Residues 150 to 238 are 35% similar to a P69 precursor domain as seen in YDHO_ECOLI.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 151 to 265 (E-value = 2e-09) place CT127 in the NLPC_P60 family which is described as NlpC/P60 family (PF00877)

PDB Hit:
none

Gene Protein Sequence:
MPHQVLLSPVCDLLSNAEGIETQVLFGERICNHNHRHYAYSQLVFSSIWK
PYPGDSLQNIPLFSSQLQPPNAVVCSQEAFLDPWHIPLPFAAPLHIDNQN
QVSLSPASIALLNSNSRSNYAKAFCSTKEIRFLNSSFSPRDLVSFAEQLI
DTPYVWGGRCIHKQLPRNGVDCSGYIQLLYQVTGRNIPRNARDQYRDCSP
VKDFSSLPIGGLIFLKKASTGQINHVMMKISEHEFIHAAEKIGKVEKVIL
GNRAFFKGNLFCSLGEPPIEAVFGVPKNRKAFF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGCACCAAGTCTTATTGTCTCCTGTTTGCGATCTTTTATCGAATGC
TGAAGGTATAGAGACGCAAGTACTGTTTGGAGAAAGGATATGCAACCATA
ACCATCGACACTATGCCTATTCTCAACTAGTCTTTTCTTCTATATGGAAG
CCATACCCTGGCGACTCTCTACAGAATATTCCTCTATTCTCTTCCCAACT
GCAGCCTCCTAATGCTGTTGTCTGCTCTCAAGAAGCTTTTTTAGATCCTT
GGCATATCCCCTTACCTTTTGCCGCTCCGCTCCACATAGATAACCAAAAT
CAAGTGTCCCTATCTCCTGCTAGCATAGCATTATTAAATTCCAATTCCAG
AAGTAACTATGCAAAAGCTTTCTGCTCTACCAAAGAGATTCGTTTTTTAA
ATTCTTCATTCTCTCCAAGAGATTTAGTTTCTTTCGCAGAACAATTGATA
GATACTCCGTACGTTTGGGGTGGCCGGTGCATTCATAAACAGCTTCCTCG
TAATGGTGTAGATTGTTCGGGGTATATTCAACTACTTTACCAAGTCACAG
GAAGAAATATCCCTCGCAATGCTAGAGATCAATACAGAGACTGTTCTCCA
GTAAAAGATTTCTCGTCTCTACCTATAGGAGGACTTATCTTCCTCAAGAA
AGCAAGCACGGGACAAATCAACCATGTTATGATGAAAATCTCGGAGCATG
AATTCATTCATGCTGCGGAAAAAATAGGGAAAGTAGAAAAAGTAATCCTA
GGAAATAGGGCTTTCTTTAAAGGGAATCTATTCTGCTCATTAGGTGAACC
GCCTATAGAAGCTGTTTTTGGCGTTCCTAAAAATAGAAAAGCCTTCTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy