Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR109 IGR102 IGR105 IGR106 IGR100 IGR101 IGR107 IGR108 IGR104 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 rpe,araD, - CT121 accC, - CT124 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 rpe,araD, - CT121 accC, - CT124 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 glnP, - CT129 glnQ, - CT130 rpe,araD, - CT121 accC, - CT124 efp1, - CT122 efp1, - CT122
* Calculated from Protein Sequence

Gene ID: CT126

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs9  

Definition:
30S ribosomal protein S9

Gene Start:
141972

Gene Stop:
142358

Gene Length:
387

Molecular Weight*:
14544

pI*:
11.67

Net Charge*:
16.99

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to 30S ribosomal protein S9 proteins, e.g., 38% similarity to RS9_ECOLI, 37% similarity to RS9_BACST.
CT126 is similar to TP1024 in T.pallidum and to MG417 in M.genitalium,
both predicted S9 sequences.

CT126 is orthologously related to CPn0246:
residues 2-129 are 78% similar to residues
6-134 of CPn0246.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0103
COG name: Ribosomal protein S9
Functional Class:  J
The phylogenetic pattern of COG0103 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 9-30, 7-28, 51-86, 103-129 are significantly matched to blocks BL00360A,B,C, concerned with ribosomal protein S9 proteins, e.g., RS9_MYCLE and RS9_STRCO.

ProDom Summary:  Protein Domain Search
Residues 25 to 86 are 51% similar to a 30S ribosomal protein domain as seen in RS9_STRCO.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 9 to 129 (E-value = 6.3e-45) place CT126 in the Ribosomal_S9 family which is described as Ribosomal protein S9/S16 (PF00380)

PDB Hit:
none

Gene Protein Sequence:
MIQESVATGRRKQAVSSVRLRSGNGKIDVNGKTLEQYFPLEVQRATILAP
LRMLGDVNSFDLIIRVSGGGVQGQVIATRLGLARAVLQEKEDMKQELKAQ
GFLTRDPRKKERKKYGRKKARKSFQFSKR

Gene Nucleotide Sequence:  Sequence Viewer
ATGATACAAGAGTCTGTTGCAACAGGCAGAAGAAAGCAGGCTGTTTCTAG
CGTTCGTCTTCGTTCTGGAAATGGAAAAATTGACGTAAATGGAAAGACTT
TAGAGCAATATTTCCCTCTTGAAGTTCAAAGAGCAACCATCTTAGCTCCG
CTCAGAATGCTCGGTGATGTCAACAGTTTCGATTTGATTATCCGAGTAAG
TGGAGGAGGGGTTCAAGGTCAGGTTATTGCTACTCGATTGGGTTTAGCTA
GAGCTGTTCTGCAAGAGAAAGAAGACATGAAGCAAGAATTGAAGGCTCAA
GGCTTCTTGACTCGAGATCCTCGTAAGAAAGAGCGTAAAAAATACGGTCG
TAAGAAAGCTCGTAAGAGTTTCCAATTCTCCAAACGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy