Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR109 IGR102 IGR105 IGR106 IGR100 IGR101 IGR107 IGR99 IGR108 IGR104 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 CT118 glnP, - CT129 rpe,araD, - CT121 glnQ, - CT130 accC, - CT124 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 CT118 glnP, - CT129 rpe,araD, - CT121 glnQ, - CT130 accC, - CT124 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 CT131 rs9, - CT126 rl13, - CT125 accB, - CT123 CT118 glnP, - CT129 rpe,araD, - CT121 glnQ, - CT130 accC, - CT124 efp1, - CT122 efp1, - CT122
* Calculated from Protein Sequence

Gene ID: CT125

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl13  

Definition:
50S ribosomal protein L13

Gene Start:
141494

Gene Stop:
141943

Gene Length:
450

Molecular Weight*:
16834

pI*:
11.01

Net Charge*:
17.95

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
THIS PROTEIN IS ONE OF THE EARLY ASSEMBLY PROTEINS OF THE 50S RIBOSOMAL SUBUNIT.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to 50S ribosomal protein L13 proteins, e.g., 53% similarity to RL13_ECOLI, 52% similarity to RL13_HAESO.
CT125 is similar to TP1025 in T.pallidum and to MG418 in M.genitalium,
both opredicted L13 sequences.

CT125is orthologously related to CPn0247:
residues 149 are 75% similar to residues 1-148 of CPn0247.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0102
COG name: Ribosomal protein L13
Functional Class:  J
The phylogenetic pattern of COG0102 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 43-82, 102-113, 114-143 are significantly matched to blocks BL00783A,B,C, concerned with ribosomal protein L13 proteins, e.g., RL13_BACSU and RL13_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 20 to 69 are 68% similar to a 50S ribosomal protein domain as seen in RL13_STACA.
Residues 24 to 75 are 42% similar to a 60S ribosomal protein domain as seen in RL13_METJA.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 22 to 150 (E-value = 2.6e-50) place CT125 in the Ribosomal_L13 family which is described as Ribosomal protein L13 (PF00572)

PDB Hit:
none

Gene Protein Sequence:
MEKRKDTKTTLAKASDDRNKAWYVVNAEGKTLGRLSSEVAKILRGKHKVT
FTPHVAMGDGVIVINAEKVRLTGAKRAQKVYHYYTGFISGMREVPFENMI
ARKPAYVIEHAVKGMLPKTKLGRRQMKSLRVLKGSSYAQYEAIKPIVLDA


Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAAGAAAAGATACGAAAACGACCCTAGCTAAGGCTTCGGACGA
TCGAAACAAAGCCTGGTATGTAGTTAATGCTGAAGGGAAGACCTTAGGGA
GATTATCTTCAGAAGTTGCGAAGATCCTGAGAGGTAAGCATAAGGTGACT
TTTACTCCTCACGTAGCGATGGGAGATGGTGTCATTGTGATCAATGCTGA
GAAAGTGCGTTTGACTGGCGCAAAAAGAGCTCAGAAAGTGTATCACTATT
ACACAGGCTTTATTTCTGGGATGCGAGAAGTTCCTTTTGAAAACATGATT
GCGCGAAAGCCTGCTTATGTTATCGAGCATGCTGTTAAAGGAATGTTGCC
TAAAACAAAACTTGGAAGACGTCAAATGAAATCTTTAAGAGTTTTGAAAG
GTAGTTCTTACGCACAGTATGAAGCTATCAAACCAATTGTTTTAGACGCG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy