Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR97 IGR102 IGR105 IGR106 IGR100 IGR101 IGR96 IGR98 IGR107 IGR99 IGR108 IGR104 IGR95 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 CT117 rs9, - CT126 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 glnP, - CT129 rpe,araD, - CT121 accC, - CT124 CT114 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 CT117 rs9, - CT126 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 glnP, - CT129 rpe,araD, - CT121 accC, - CT124 CT114 CT120 adk, - CT128 incA, - CT119 ydhO, - CT127 rs9, - CT126 CT116 rl13, - CT125 accB, - CT123 CT118 glnP, - CT129 rpe,araD, - CT121 accC, - CT124 CT114 efp1, - CT122 efp1, - CT122 CT117 CT115
* Calculated from Protein Sequence

Gene ID: CT123

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accB  

Definition:
biotin carrier protein of acetyl-COA carboxylase (BCCP)

Gene Start:
139400

Gene Stop:
139891

Gene Length:
492

Molecular Weight*:
18183

pI*:
4.89

Net Charge*:
-4.04

EC:
6.4.1.2  

Functional Class:
energy metabolism; pyruvate metabolism  
fatty acid and phospholipid metabolism  

Pathway: pathway table
Carbohydrate Metabolism; Pyruvate metabolism
Lipid Metabolism; Fatty acid biosynthesis

Comment:
Active in the first step of long-chain fatty acid synthesis as well as in
pyruvate metabolism. See CT265, CT293 and CT124.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to biotin carrier protein of acetyl-COA carboxylase (BCCP) sequences, e.g., 33% similarity to BCCP_BACSU, 30% similarity to BCCP_PSEAE.
CT123 has no similarity to T.pallidum or M.genitalium.

CT123 is orthologous to CPn0183: residues 1-163 are 75% similar to CPn0183.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0511
COG name: Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Functional Class:  I
The phylogenetic pattern of COG0511 is AmtKYQvceBRhuj---linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 107-144 are significantly matched to blocks BL00189A, concerned with 2-oxo acid dehydrogenases proteins, e.g., ODP2_BACST.
Residues 100-136, 127-163 are significantly matched to blocks BL00188, concerned with biotin-requiring enzymes attachment site proteins, e.g., BCCP_HAEIN.

ProDom Summary:  Protein Domain Search
Residues 108 to 141 are 50% similar to a dehydrogenase domain as seen in BCCP_ANASP.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 87 to 161 (E-value = 1.2e-27) place CT123 in the Biotin_lipoyl family which is described as Biotin-requiring enzyme (PF00364)

PDB Hit:
gi|1827931|pdb|1BDO| Structure Of The Biotinyl Domain Of Acetyl-Coenzyme A Carboxylase Determined By Mad Phasing Bccpsc, Carboxyl Transferase, Fatty Acid Biosynthesis, Hammerhead Structure, Selenomethionine, Ligase Mol_id: 1; Molecule: Acetyl-Coa Carboxy

Gene Protein Sequence:
MDLKQIEKLMIAMGRNKMKRIVIKREGLELELERDTVPSIQEPVFYDNRL
FAGFSQERPIPTDQNLGNPIVKESIEKKESEAPAQGDFIVSPLVGTFYGS
PSPEAPAFIKPGDTVSEDTVVCIVEAMKVMNEVKAGMSGRVEEILITNGD
PVQFGSKLFRIVKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTAAAGCAGATAGAAAAGCTCATGATTGCTATGGGCCGTAATAA
AATGAAGCGCATTGTTATCAAGCGTGAAGGTTTGGAGTTAGAGTTAGAAA
GGGATACAGTCCCAAGTATTCAGGAGCCAGTCTTTTATGATAACAGACTG
TTTGCTGGATTTTCCCAAGAAAGACCTATTCCTACAGATCAAAACCTTGG
GAATCCTATTGTTAAAGAGAGTATCGAGAAGAAAGAAAGTGAGGCGCCTG
CTCAGGGAGATTTTATTGTTTCTCCGCTGGTAGGCACTTTTTATGGCTCT
CCTTCGCCAGAGGCTCCAGCATTTATTAAGCCTGGGGATACTGTTTCAGA
GGATACCGTTGTTTGTATCGTGGAAGCTATGAAGGTAATGAACGAGGTAA
AGGCAGGAATGTCTGGTCGCGTAGAAGAAATATTGATTACTAATGGTGAT
CCAGTCCAGTTTGGTTCTAAGTTATTCCGTATAGTTAAGGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy