Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR97 IGR102 IGR105 IGR94 IGR106 IGR100 IGR101 IGR96 IGR98 IGR99 IGR104 IGR95 CT120 incA, - CT119 ydhO, - CT127 CT117 rs9, - CT126 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 ydhO, - CT127 CT117 rs9, - CT126 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 ydhO, - CT127 rs9, - CT126 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 efp1, - CT122 efp1, - CT122 CT117
* Calculated from Protein Sequence

Gene ID: CT120

DNA Molecule Name:
1  

Genbank ID:
3328519

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
138058

Gene Stop:
137819

Gene Length:
240

Molecular Weight*:
9056

pI*:
8.37

Net Charge*:
2.56

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
No similarity to C. pneumoniae.

Blast Summary:  PSI-Blast Search
None.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis. However, residues 19-53 are similar to regions in 3',5'-cyclic-GMP-specific phosphodiesterases from bovine (accessions A48719, Q28156), Canis familiaris (accession AB008468), Homo sapiens (accession D89094, AB001635), Rattus norvegicus (U76032).

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
None.

Gene Protein Sequence:
MAIIFGELRVSLYPPFLFTYISRQAHPKAILHCADKNFLESLHSNQCFRI
ANATCSTLSYMQKLIVNPVNNINANALENM

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAATTATTTTTGGGGAACTAAGAGTTTCCCTCTATCCTCCTTTTCT
CTTTACATACATTTCACGACAGGCACACCCCAAAGCGATTCTGCACTGCG
CAGACAAGAATTTTCTTGAATCCCTCCATAGCAATCAGTGCTTTCGTATC
GCCAATGCAACATGTTCTACTCTGTCCTATATGCAGAAATTGATCGTTAA
TCCAGTCAACAATATTAATGCAAATGCTTTAGAAAACATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy