Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR97 IGR102 IGR94 IGR105 IGR100 IGR101 IGR96 IGR98 IGR99 IGR104 IGR95 CT120 incA, - CT119 CT117 rs9, - CT126 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 CT117 rs9, - CT126 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 rs9, - CT126 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 efp1, - CT122 efp1, - CT122 CT117
* Calculated from Protein Sequence

Gene ID: CT119

DNA Molecule Name:
1  

Genbank ID:
3328518

Gene Name:
incA  

Definition:
inclusion membrane protein A

Gene Start:
137738

Gene Stop:
136920

Gene Length:
819

Molecular Weight*:
30313

pI*:
8.62

Net Charge*:
2.88

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Primary Evidence:
Bannantine JP, Stamm WE, Suchland RJ, Rockey DD. 1998. Chlamydia trachomatis IncA is localized to the inclusion membrane and is recognized by antisera from infected humans and primates. Infect Immun 66(12):6017-21. Medline: 9826388.

Bannantine JP, Rockey DD, Hackstadt T. 1998. Tandem genes of Chlamydia psittaci that encode proteins localized to the inclusion membrane. Mol Microbiol 28(5):1017-26 (1998). Medline: 9663687.


Rockey DD, Grosenbach D, Hruby DE, Peacock MG, Heinzen RA, Hackstadt T. 1997. Chlamydia psittaci IncA is phosphorylated by the host cell and is exposed on the cytoplasmic face of the developing inclusion. Mol Microbiol 24(1):217-28 (1997). Medline:
9140978.

Rockey DD, Heinzen RA, Hackstadt T. 1995. Cloning and characterization of a Chlamydia psittaci gene coding for a protein localized in the inclusion membrane of infected cells. Mol Microbiol 15(4):617-26 (1995). Medline: 7783634.

Comment:
This protein has been shown to be associated with the inclusion body membrane.

See CT232 (putative incB) and CT233 (putative incC).

No similarity to C.pneumoniae.

Blast Summary:  PSI-Blast Search
Single hit in gapped BLAST to an inclusion membrane protein A from Chlamydia psittaci: residues 42-251 are 21% similar to this protein. No similarity to C.pneumoniae.

No significant similarities to T.pallidum or M.genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 95 to 260 are 28% similar to an alpha-internexin domain as seen in AINX_MOUSE.

Paralogs:  Local Blast Search
CT119 is paralogously related (distant) to CT329, an exodeoxyribonuclease: residues 110-260 are 20% similar to CT329.

Pfam Summary:  Pfam Search
Residues 1 to 268 (E-value = 2.4e-229) place CT119 in the IncA family which is described as IncA protein (PF04156)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
36  
57
transmembrane  
61  
82
coil-coil  
93  
123
coil-coil  
142  
188
coil-coil  
206  
247

PDB Hit:
None.

Gene Protein Sequence:
MTTPTLIVTPPSPPAPSYSANRVPQPSLMDKIKKIAAIASLILIGTIGFL
ALLGHLVGFLIAPQITIVLLALFIISLAGNALYLQKTANLHLYQDLQREV
GSLKEINFMLSVLQKEFLHLSKEFATTSKDLSAVSQDFYSCLQGFRDNYK
GFESLLDEYKNSTEEMRKLFSQEIIADLKGSVASLREEIRFLTPLAEEVR
RLAHNQQSLTVVIEELKTIRDSLRDEIGQLSQLSKTLTSQIALQRKESSD
LCSQIRETLSSPRKSASPSTKSS

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACGCCTACTCTAATCGTGACCCCTCCATCTCCCCCTGCACCTTC
CTACTCAGCCAATCGCGTACCTCAACCTTCTTTGATGGACAAAATTAAGA
AAATAGCAGCCATTGCCTCCCTAATTCTTATAGGCACAATAGGCTTTTTA
GCTCTTTTGGGACATCTTGTTGGCTTTCTGATCGCTCCACAAATCACTAT
TGTTCTTCTTGCCCTATTCATTATCTCATTAGCAGGGAATGCTCTTTATC
TACAGAAAACCGCTAATCTACATCTATACCAGGATCTGCAAAGAGAAGTT
GGGTCTCTAAAAGAAATTAATTTCATGCTGAGCGTTCTACAGAAAGAATT
TCTTCATTTATCTAAAGAATTTGCAACGACATCTAAAGACCTCTCTGCTG
TATCTCAAGATTTTTATTCTTGTTTGCAAGGATTTAGAGATAACTATAAA
GGTTTTGAATCTCTTTTGGATGAGTATAAAAACTCTACAGAAGAAATGCG
CAAACTTTTTTCGCAAGAAATCATAGCAGATCTTAAAGGCTCTGTTGCCT
CATTAAGAGAGGAAATCCGATTCCTAACCCCATTAGCAGAAGAAGTTCGC
CGATTAGCGCATAACCAGCAATCATTAACAGTGGTTATTGAAGAATTAAA
AACAATTCGTGATAGCTTACGAGATGAAATTGGACAACTTTCACAACTTT
CTAAAACTCTTACCAGTCAAATTGCATTACAACGAAAAGAGAGCTCAGAT
CTGTGTTCCCAGATAAGAGAGACGCTCTCCTCCCCCAGAAAGTCTGCATC
ACCCTCTACAAAAAGCTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy