Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR97 IGR102 IGR94 IGR100 IGR101 IGR96 IGR98 IGR99 IGR104 IGR95 CT120 incA, - CT119 CT117 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 CT117 CT116 CT115 rl13, - CT125 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 CT116 CT115 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 efp1, - CT122 efp1, - CT122 CT117
* Calculated from Protein Sequence

Gene ID: CT118

DNA Molecule Name:
1  

Genbank ID:
3328517

Gene Name:


Definition:
hypothetical protein

Gene Start:
136248

Gene Stop:
136748

Gene Length:
501

Molecular Weight*:
17389

pI*:
6.95

Net Charge*:
-0.06

EC:
 

Functional Class:
hypothetical  

Pathway: pathway table

Comment:
No similarity to C. pneumoniae.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST, however residues 146-167 are 59% similar to a stretch of GTS1_YEAST.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
CT118 is weakly paralogous to CT117, another hypothetical: residues 21-84 are 31% similar to CT117. Note high serine content in this region.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
33  
59
transmembrane  
63  
88
non-globular  
89  
167

PDB Hit:
None.

Gene Protein Sequence:
MICCDKVLSSVQSMPVIDKCSVTKCLQTAKQAAVLALSLFAVFASGSLSI
LSAAVLFSGTAAVLPYLLILTTALLGFVCAVIVLLRNLSAVVQSCKKRSP
EEIEGAARPSDQQESGGRLSEESASPQASPTSSTFGLESALRSIGDSVSG
AFDDINKDNSRSRSHSF

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCTGCTGTGACAAAGTCTTGTCGAGCGTACAATCAATGCCTGTTAT
AGATAAATGCTCTGTAACGAAATGCTTACAAACGGCTAAGCAAGCAGCTG
TTCTTGCGTTGTCTTTGTTTGCGGTGTTTGCTTCAGGAAGTTTATCCATA
TTATCAGCGGCGGTACTGTTTAGTGGCACTGCTGCTGTTCTTCCATATCT
GCTGATATTAACAACAGCTCTTCTAGGATTTGTTTGTGCTGTTATTGTGC
TTTTAAGAAATTTATCAGCAGTTGTTCAGAGTTGTAAAAAGAGATCACCT
GAAGAAATTGAAGGGGCTGCTCGTCCCTCTGATCAGCAGGAATCAGGAGG
ACGTTTGTCCGAGGAGAGCGCTTCACCACAAGCATCTCCTACTTCGTCTA
CTTTTGGTCTTGAATCCGCTTTGCGCTCAATAGGAGATAGTGTTTCTGGG
GCATTCGATGATATAAATAAGGACAACAGCCGTTCTCGATCACACTCCTT
C


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy