Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR97 IGR102 IGR94 IGR100 IGR101 IGR96 IGR98 IGR99 IGR95 CT120 incA, - CT119 CT117 CT116 CT115 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 CT117 CT116 CT115 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 CT117 CT115 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 efp1, - CT122 efp1, - CT122 CT116
* Calculated from Protein Sequence

Gene ID: CT116

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
135444

Gene Stop:
135839

Gene Length:
396

Molecular Weight*:
13539

pI*:
7.46

Net Charge*:
1.03

EC:
 

Functional Class:
hypothetical  

Pathway: pathway table

Comment:
No similarity to C. pneumoniae.

Blast Summary:  PSI-Blast Search
None.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis, however residues 34-80 are 36% similar to a stretch of CT194, a transporter sequence.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
40  
61
transmembrane  
65  
85

PDB Hit:
None.

Gene Protein Sequence:
MECVKQLCRNHLCLDSLTGPVRSVLTQGTTAEKVQLVVSCLGVVCSIICL
ALGIAAAAVGVSCSGFAIGLGVIAILLGIVLFAISALDVLEDHGLVGCPF
KLPCKSSPANEPTVQFFKGKNGSADKVILVTQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAATGCGTTAAACAGTTATGTAGAAACCATCTATGTTTAGACAGCTT
GACGGGTCCTGTGCGCTCGGTGTTGACGCAAGGAACAACTGCAGAAAAAG
TTCAGCTAGTGGTATCCTGTTTAGGAGTTGTTTGTTCGATTATTTGTTTA
GCTTTGGGAATCGCTGCAGCGGCAGTGGGTGTTTCGTGTAGTGGATTTGC
TATTGGATTGGGTGTTATCGCCATTCTTTTAGGGATTGTATTGTTTGCAA
TATCTGCTTTGGATGTTCTAGAGGATCATGGTTTGGTGGGATGTCCATTT
AAGTTGCCATGCAAATCGAGTCCAGCTAATGAACCTACTGTACAATTCTT
TAAAGGTAAAAATGGAAGCGCAGACAAAGTGATTTTAGTAACTCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy