Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR103 IGR97 IGR102 IGR94 IGR100 IGR101 IGR96 IGR98 IGR99 IGR95 IGR93 CT120 incA, - CT119 pepF, - CT112 CT117 CT116 CT115 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 pepF, - CT112 CT117 CT116 CT115 accB, - CT123 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 CT120 incA, - CT119 pepF, - CT112 CT116 CT115 CT118 rpe,araD, - CT121 accC, - CT124 CT114 clpB, - CT113 efp1, - CT122 efp1, - CT122 CT117 accB, - CT123
* Calculated from Protein Sequence

Gene ID: CT115

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein (basic)

Gene Start:
134936

Gene Stop:
135358

Gene Length:
423

Molecular Weight*:
14912

pI*:
9.47

Net Charge*:
5.04

EC:
 

Functional Class:
hypothetical  

Pathway: pathway table

Comment:
No similarity to C. pneumoniae.

Blast Summary:  PSI-Blast Search
None.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 29-53, 36-59, 37-61, 52-76, 53-77 are similar to blocks PR00122A, B, D,
which include vacuolar ATP synthase sequences e.g. VM11_YEAST.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
38  
62
transmembrane  
66  
89

PDB Hit:
None.

Gene Protein Sequence:
MTKVYANSIQQERVVDRIALLERCLDPSNSLPTAKRLVAVAVATILAVAL
LVVAGLLFSGVLCSPVSVLAASLFFGVGAFLLGGALVGGVLTTEAVTRER
LHRSQTLMWNNLCCKTAEVEQKISTASANAKSNDKTRKLGE

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAAGGTTTATGCGAATAGCATTCAGCAAGAGAGAGTTGTGGATAG
GATAGCTCTTTTAGAGAGATGCTTAGACCCGAGTAATTCATTGCCGACAG
CGAAAAGATTGGTGGCAGTTGCTGTGGCCACTATATTGGCCGTCGCTCTT
CTAGTTGTTGCGGGCTTGTTGTTCTCTGGAGTGCTCTGTAGCCCTGTTTC
TGTTTTAGCGGCATCTTTATTCTTCGGGGTAGGAGCTTTCCTTTTAGGAG
GAGCTTTGGTTGGAGGAGTGCTGACTACAGAAGCTGTGACTAGAGAGCGG
TTGCATCGATCACAAACTTTGATGTGGAACAACTTATGCTGTAAAACAGC
AGAGGTTGAGCAGAAAATCTCGACAGCTAGTGCAAATGCCAAAAGCAATG
ATAAGACTCGAAAACTCGGTGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy