Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR97 IGR94 IGR100 IGR101 IGR96 IGR98 IGR99 IGR95 IGR93 CT120 incA, - CT119 pepF, - CT112 CT117 CT116 CT115 CT118 rpe,araD, - CT121 CT114 clpB, - CT113 CT120 incA, - CT119 pepF, - CT112 CT117 CT116 CT115 CT118 rpe,araD, - CT121 CT114 clpB, - CT113 CT120 incA, - CT119 pepF, - CT112 CT117 CT115 CT118 rpe,araD, - CT121 CT114 clpB, - CT113 efp1, - CT122 efp1, - CT122 CT116
* Calculated from Protein Sequence

Gene ID: CT114

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
133246

Gene Stop:
134703

Gene Length:
1458

Molecular Weight*:
55146

pI*:
7.31

Net Charge*:
1.26

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT114 is orthologously related to CPn0145: residues 26-485 are 46% similar
to CPn0145, a Chlamydia-specific hypothetical protein from C. pneumoniae.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 183-196 are matched to block BL00821B, concerned with cytochrome c lyase sequences, e.g. CCHL_CANAL.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
17
non-globular  
52  
168
non-globular  
287  
433

PDB Hit:
none

Gene Protein Sequence:
MCFIGIGSLLLPTALRATERMRKEPIPLLDKQQSFWNVDPYCLESICACF
VAHRDPLSAKQLMYLFPQLSEEDVSVFARCILSSKRPEYLFSKSEEELFA
KLILPRVSLGVHRDDDLARVLVLAEPSAEEQKARYYSLYLDVLALRAYVE
RERLASAAHGDPERIDLATIEAINTILFQEEGWRYPSKQEMFENRFSELA
AVTDSKFGVCLGTVVLYQAVAQRLDLSLDPVTPPGHIYLRYKDKVNIETT
SGGRHLPTERYCECIKESQLKVRSQMELIGLTFMNRGAFFLQKGEFLQAS
LAYEQAQSYLSDEQISDLLGITYVLLGKKAAGEALLKKSAEKTRRGSSIY
DYFQGYISPEILGVLFADSGVTYQETLEYRKKLVMLSKKYPKSGSLRLRL
ATTALELGLVKEGVQLLEESVKDAPEDLSLRLQFCKILCNRHDYVRAKYH
FDQAQALLIKEGLFSEKTSYTLLKTIGKKLSLFAPS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGCTTTATTGGGATAGGCAGTCTTCTGTTACCGACCGCTCTGCGAGC
GACTGAACGGATGAGAAAGGAGCCTATCCCGCTCCTAGATAAGCAACAAA
GCTTTTGGAATGTAGATCCTTATTGTCTGGAATCTATATGCGCTTGTTTT
GTAGCGCATCGAGATCCTTTGAGTGCAAAACAGTTAATGTATCTGTTTCC
TCAGCTCTCAGAAGAGGATGTATCTGTTTTTGCTCGATGCATTTTGTCTT
CAAAGCGTCCAGAATACCTCTTTTCAAAATCGGAGGAAGAGCTCTTTGCA
AAATTGATTTTGCCAAGGGTTTCTCTAGGTGTTCATCGGGACGATGATTT
AGCGAGAGTGTTGGTGTTAGCGGAGCCTTCTGCAGAAGAGCAGAAGGCTC
GATACTATTCATTGTATCTGGATGTTTTAGCTTTGCGTGCATACGTTGAA
AGAGAGCGTTTGGCGAGTGCTGCACACGGAGATCCTGAGCGGATAGATTT
GGCAACCATAGAAGCTATTAATACCATCCTTTTTCAGGAAGAAGGATGGA
GGTATCCTTCAAAACAAGAGATGTTTGAAAACAGGTTTTCTGAGTTAGCT
GCTGTTACAGATAGTAAGTTTGGAGTTTGCTTGGGAACTGTAGTGCTTTA
TCAAGCTGTCGCCCAGCGGCTTGATTTGTCTCTGGACCCTGTCACCCCTC
CTGGACATATTTACTTACGCTATAAGGACAAGGTGAATATTGAAACCACT
TCTGGAGGAAGGCATCTTCCTACTGAAAGGTATTGTGAATGCATAAAAGA
GTCGCAGTTAAAGGTGCGTTCGCAGATGGAGCTTATAGGGTTAACTTTTA
TGAATAGAGGAGCTTTCTTTTTGCAAAAAGGAGAGTTTCTTCAGGCGTCC
TTAGCTTATGAGCAAGCTCAATCATATTTATCAGACGAGCAGATTTCTGA
TTTGTTAGGGATTACTTATGTTCTTTTAGGAAAGAAGGCGGCGGGAGAGG
CTCTTTTAAAGAAATCTGCAGAAAAGACTCGGCGAGGGTCATCTATCTAT
GACTATTTCCAAGGATATATTTCCCCCGAAATCCTAGGGGTGTTGTTTGC
CGATTCAGGGGTGACCTATCAAGAAACTTTGGAGTATCGAAAAAAACTAG
TGATGCTTTCCAAGAAGTATCCAAAAAGTGGATCTCTTAGGTTGAGGTTG
GCGACAACAGCATTGGAGCTAGGGCTGGTCAAGGAGGGGGTGCAGTTGTT
AGAAGAGAGTGTTAAGGATGCCCCAGAGGACCTCTCTTTACGTCTGCAGT
TTTGTAAAATTCTTTGCAATCGACATGATTATGTCCGAGCAAAATATCAT
TTTGATCAAGCGCAAGCTCTTCTCATTAAAGAAGGGTTGTTTTCCGAAAA
AACTTCCTATACTCTCTTAAAAACTATCGGGAAAAAGCTATCTCTTTTTG
CTCCGAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy