Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR89 IGR91 IGR87 IGR88 IGR86 IGR90 IGR92 IGR85 groES, - CT111 CT109 fabI, - CT104 sfhB, - CT106 groEL, - CT110 pepF, - CT112 ybgI, - CT108 CT103 mutY, - CT107 CT105 groES, - CT111 CT109 fabI, - CT104 sfhB, - CT106 groEL, - CT110 pepF, - CT112 ybgI, - CT108 CT103 mutY, - CT107 CT105 groES, - CT111 CT109 fabI, - CT104 sfhB, - CT106 groEL, - CT110 pepF, - CT112 ybgI, - CT108 CT103 mutY, - CT107 CT105
* Calculated from Protein Sequence

Gene ID: CT107

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mutY  

Definition:
A/G-specific adenine glycosylase

Gene Start:
123493

Gene Stop:
124599

Gene Length:
1107

Molecular Weight*:
42670

pI*:
8.65

Net Charge*:
7.80

EC:
4.2.99.18  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:
Attacks G-A and C-A mispairs in DNA.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to A/G-specific adenine glycosylase proteins, e.g., 29% similarity to YAU2_SCHPO, 29% similarity to MUTY_HAEIN.
CT323 is similar to O00405 in T.pallidum. No similarity to M.genitalium.

CT107 is orthologously related to CPn0402:
residues 1-353 are 52% similar to residues
1-356 of CPn0402.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1194
COG name: A/G-specific DNA glycosylase
Functional Class:  L
The phylogenetic pattern of COG1194 is --t-----ebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 96-150, 187-214 are significantly matched to blocks BL00764B,C, concerned with endonuclease III iron-sulfur binding region proteins, e.g., END3_BACSU and END3_CAEEL.

ProDom Summary:  Protein Domain Search
Residues 38 to 201 are 40 % similar to a endonuclease domain as seen in MUTY_SALTY.

Paralogs:  Local Blast Search
CT323 is paralogously related to CT697, a endonuclease III family protein: residues 8-154 are 21% similar to CT697.

Pfam Summary:  Pfam Search
Residues 42 to 177 (E-value = 1.6e-21) place CT107 in the HhH-GPD family which is described as HhH-GPD superfamily base excision DNA repair protein (PF00730)
Residues 106 to 135 (E-value = 2.5e-05) place CT107 in the HHH family which is described as Helix-hairpin-helix motif (PF00633)

PDB Hit:
gi|1311214|pdb|2ABK| Refinement Of The Native Structure Of Endonuclease Iii To A Resolution Of 1.85 Angstrom Dna-Repair, Dna Glycosylase Mol_id: 1; Molecule: Endonuclease Iii; Chain: Null; Ec: 4.2.99.18

Gene Protein Sequence:
MIRTAFFQDKKCFPLEALRSWFLESKRSFPWRDSPTPYRVWVSEVMLQQT
RAEVVVPYFLKWMERFPTLQDLAQARESDVVQLWEGLGYYSRARNLLAGA
RVITEIFGGEIPNDLALLSSIKGIGSYTANAILAFAFKQKNPAVDGNVLR
VMSRLFAIEESIDRMNTRREITGLCESLLPDQDPQVIAESFIELGARICK
KQPLCEQCPLRSFCTAYRQGTMEQYPVRNTRAAISRLFRAVVIVLYKDQV
LMTKREEKEIMAGLYEFPYYQLPKEDCCDIEKITHLVQKDYGETLHFVSS
LPSQKQVFTRYRVTLFPHVFYTKYSLPNSYTLAELSSLPSSSGHRRIKET
FLVEYHKSLEKMVSCSGDK

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAAGAACAGCTTTTTTCCAAGATAAAAAGTGTTTTCCTCTGGAAGC
TTTACGTTCATGGTTTCTTGAAAGTAAAAGATCGTTCCCTTGGAGAGATT
CTCCGACTCCTTATCGGGTTTGGGTTTCAGAGGTTATGCTTCAACAAACT
CGAGCAGAAGTGGTGGTTCCGTATTTTTTGAAGTGGATGGAAAGATTCCC
GACTTTACAAGATCTTGCGCAAGCAAGAGAAAGCGATGTGGTGCAGCTTT
GGGAGGGGCTAGGTTATTATTCTCGGGCTAGGAACTTGCTAGCCGGAGCT
CGTGTTATTACAGAGATTTTCGGAGGAGAAATCCCAAACGATTTAGCGCT
TCTTAGCTCCATTAAGGGGATTGGGTCTTATACAGCAAATGCTATCCTTG
CATTTGCATTTAAGCAAAAAAATCCTGCTGTTGATGGGAATGTTTTGCGT
GTGATGAGTCGATTATTTGCTATAGAGGAATCCATCGATCGTATGAACAC
GCGAAGAGAGATCACAGGGCTTTGTGAGAGTTTGCTTCCAGATCAGGATC
CTCAAGTCATAGCAGAGTCTTTTATCGAGTTGGGAGCAAGAATTTGTAAG
AAACAGCCTCTTTGTGAACAGTGTCCGTTGCGTTCATTTTGTACAGCATA
TCGACAAGGGACTATGGAACAATACCCTGTCAGAAATACACGAGCAGCTA
TTTCCAGGTTATTTCGAGCTGTTGTGATTGTTTTGTATAAGGATCAGGTC
TTGATGACAAAACGCGAAGAGAAAGAGATCATGGCAGGTTTGTATGAGTT
CCCTTACTACCAGCTTCCCAAAGAAGATTGTTGTGATATTGAGAAAATCA
CTCATCTTGTTCAGAAAGATTATGGAGAGACGCTGCATTTTGTTAGTAGT
CTTCCTTCTCAAAAGCAGGTATTTACTCGCTATCGCGTTACACTATTCCC
ACATGTTTTCTACACAAAATATAGTTTACCGAATAGCTACACGTTAGCAG
AGCTATCAAGTCTCCCAAGCTCATCAGGACATCGCAGAATTAAAGAGACT
TTTTTAGTCGAGTATCATAAGTCTTTGGAAAAGATGGTAAGCTGTTCTGG
AGATAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy