Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR89 IGR84 IGR91 IGR87 IGR88 IGR86 IGR90 IGR85 CT109 fabI, - CT104 sfhB, - CT106 groEL, - CT110 CT102 ybgI, - CT108 CT103 mutY, - CT107 CT105 CT109 fabI, - CT104 sfhB, - CT106 groEL, - CT110 CT102 ybgI, - CT108 CT103 mutY, - CT107 CT105 CT109 fabI, - CT104 sfhB, - CT106 groEL, - CT110 CT102 ybgI, - CT108 CT103 mutY, - CT107 CT105
* Calculated from Protein Sequence

Gene ID: CT106

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sfhB  

Definition:
ribosomal large subunit pseudouridine synthase C (pseudouridylate synthase) (uracil hydrolyase)

Gene Start:
123446

Gene Stop:
122538

Gene Length:
909

Molecular Weight*:
34609

pI*:
10.36

Net Charge*:
16.65

EC:
4.2.1.70  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
Possible pseudouridine synthetase (yceC).

From SwissProt (P23851), RLUC_ECOLI:
[FUNCTION] the ribosomal large subunit PSEUDOURIDINE SYNTHASE C (PSEUDOURIDYLATE SYNTHASE) (URACIL HYDROLYASE)is RESPONSIBLE FOR SYNTHESIS OF PSEUDOURIDINE FROM URACIL
AT POSITIONS 955, 2504 AND 2580 IN 23S RIBOSOMAL RNA.
[SIMILARITY] BELONGS TO THE RLU FAMILY OF PSEUDOURIDINE SYNTHASES.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to conserved hypothetical proteins, e.g., 28% similarity to YLYB_BACSU, 25% similarity to SFHB_ECOLI.
CT106 is similar to TP0339 in T.pallidum and to MG209 in
M.genitalium, both hypotheticals.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0564
COG name: Predicted pseudouridylate synthase family 2
Functional Class:  J
The phylogenetic pattern of COG0564 is ----YqVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 71-91, 101-143, 206-248, 176-184, 201-225, 235-240 are significantly matched to blocks BL01129A,B,C,D,E, concerned with hypothetical yabO/yceC/sfhB family proteins, e.g., SFHB_BORBU and Y04P_MYCTU.

ProDom Summary:  Protein Domain Search
Residues 176-232 are 50% similar to a hypothetical protein domain as observed in YFII_HAEIN. Residues 63-140 are consistent with this observation.
Residues 7-61 are similar to a hypothetical protein domain as seen in YCEC_ECOLI.

Paralogs:  Local Blast Search
CT106 is paralogously related to CT658, a SFHB family of bacterial and eukaryotic Pseudouridine synthases: residues 40-261 are 30% similar to CT658.

Pfam Summary:  Pfam Search
Residues 12 to 59 (E-value = 5.8e-05) place CT106 in the S4 family which is described as S4 domain (PF01479)
Residues 77 to 213 (E-value = 6.5e-52) place CT106 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

PDB Hit:
none

Gene Protein Sequence:
MQEFIGTADRQIRLSSFLRTSLPHLPKKTILESVRYHGCRVNGRIERFES
YKLQPGDRVSLQIIEHSSPQLLWEDEHLCIYNKPAKQTSEDLAHQLNVHL
VHRLDRDTSGCILFAKHAKASSLITQLFKNREIDKRYIALVFGQPRQESG
IITTYTAPCYRRIGAVLFGNTDQNSGKITITKWEILTRYPKYTLLLCRPV
TGRTHQIRLHMKTIGHPIVGDVDYGNQEQPKNVVRTLLHAASLAFISPFS
NEKIEVSSLTPSQDPYPFYADFSLKPLKKPPINKVVLIQVVLEAKDSVSK
RIV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAGAATTTATTGGTACAGCGGATCGCCAGATAAGGCTCTCTTCTTT
TCTCCGGACTTCTCTGCCTCATCTGCCTAAAAAAACTATTTTAGAATCCG
TTCGCTATCATGGTTGCCGAGTCAATGGTCGCATTGAACGCTTCGAATCC
TATAAGCTGCAGCCCGGAGACCGAGTAAGTTTACAAATCATCGAACACTC
TTCTCCACAATTACTTTGGGAGGATGAGCATCTCTGTATTTACAATAAAC
CTGCTAAACAGACTTCCGAGGATTTGGCTCATCAGCTCAATGTTCATCTT
GTGCACCGCTTAGATCGAGATACATCAGGGTGTATTCTCTTTGCGAAACA
TGCAAAAGCCTCTTCTCTTATTACACAACTATTCAAGAATCGAGAAATAG
ATAAACGCTATATTGCTCTAGTATTTGGACAACCACGCCAAGAATCTGGA
ATCATTACAACCTATACAGCCCCCTGCTACCGTCGAATTGGTGCTGTATT
ATTTGGAAATACGGATCAGAATTCCGGTAAAATAACGATTACCAAGTGGG
AGATTCTTACCCGCTATCCCAAGTACACTTTACTTCTTTGCCGCCCCGTT
ACAGGACGCACCCATCAAATACGCTTACATATGAAAACAATCGGCCATCC
TATTGTTGGGGATGTGGATTACGGAAATCAAGAACAGCCAAAGAATGTTG
TGCGGACTTTGCTTCACGCAGCTAGCTTAGCCTTCATTTCTCCTTTCTCC
AATGAAAAAATCGAAGTCTCCTCTCTAACGCCATCACAAGACCCTTACCC
TTTTTACGCAGATTTTAGCCTTAAACCTCTTAAAAAGCCTCCAATAAACA
AAGTTGTCTTAATACAAGTAGTTCTGGAAGCTAAAGACTCGGTAAGCAAA
AGAATAGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy