Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR82 IGR81 IGR84 IGR87 IGR88 IGR86 IGR83 IGR85 IGR80 CT101 fabI, - CT104 sfhB, - CT106 rs1, - CT098 acpS, - CT100 CT102 ybgI, - CT108 CT103 trxB, - CT099 mutY, - CT107 CT105 CT101 fabI, - CT104 sfhB, - CT106 rs1, - CT098 acpS, - CT100 CT102 ybgI, - CT108 CT103 trxB, - CT099 mutY, - CT107 CT105 CT101 fabI, - CT104 sfhB, - CT106 rs1, - CT098 acpS, - CT100 CT102 ybgI, - CT108 CT103 trxB, - CT099 mutY, - CT107 CT105
* Calculated from Protein Sequence

Gene ID: CT104

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabI  

Definition:
enoyl-acp reductase

Gene Start:
120214

Gene Stop:
119321

Gene Length:
894

Molecular Weight*:
31947

pI*:
5.45

Net Charge*:
-4.79

EC:
1.3.1.9  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Lipid Metabolism; Fatty acid biosynthesis

Comment:
Appears to be paralogously related to CT237, an acyl-carrier protein reductase
(low BLAST score, but significant Evalue of 1e-06). If CT237 is involved
in the first reductive step of fatty acid biosynthesis, CT104 is involved
in the second. An X-ray structure of the chloroplast molecule is available.
See CT236, CT237, CT238, CT239, CT532, and CT770.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to enoyl-ACP reductase sequences, e.g., residues
2-293 of CT104 are 61% similar to the Arabidopsis enzyme and to the
enzyme from Brassica napus (rape seed). Residues 6-289 are 23% similar
to a hypothetical protein from B.subtilis (Y14084). No similarities to
T.pallidum or M.genitalium.

CT104 is orthologous to CPn0406: residues 1-298 are 85% similar to CPn0406.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0623
COG name: Enoyl-[acyl-carrier-protein] reductase (NADH)
Functional Class:  I
The phylogenetic pattern of COG0623 is -----q-cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 2-105 of CT104 are closely matched to a domain represented by
FABI-BRANA, an enoyl- [acyl carrier protein] reductase. These sequences are
approximately 60% similar over this region. Other domains are suggested by
residues 120-137 and 180-204 of CT104.

Paralogs:  Local Blast Search
CT104 is paralogously related to CT237, a 3-oxoacyl-(acyl-carrier protein) reductase: residues 6-284 are 24% similar to CT237.

Pfam Summary:  Pfam Search
Residues 62 to 285 (E-value = 2.9e-05) place CT104 in the adh_short family which is described as short chain dehydrogenase (PF00106)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
31  
50
transmembrane  
150  
180

PDB Hit:
gi|1827677|pdb|1ENP| Brassica Napus Enoyl Acp ReductaseNADH BINARY COMPLEX AT Ph 8.0 And Room Temperature Oxidoreductase, Plant Lipid Biosynthesis Mol_id: 1; Molecule: Enoyl Acyl Carrier Protein Reductase; Chain: Null; Ec: 1.3.1.9; Engineered: Yes; Mutat

Gene Protein Sequence:
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFS
QSLELGKFNASRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKD
LSGYTVSEVVEQVKKHFGHIDILVHSLANSPEIAKPLLDTSRKGYLAALS
TSSYSFISLLSHFGPIMNAGASTISLTYLASMRAVPGYGGGMNAAKAALE
SDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERMVDYYQDWAPL
PSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMFPKD

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAAAATTGATTTAACAGGAAAAATTGCTTTCATAGCCGGCATAGG
CGATGATAACGGGTATGGCTGGGGCATTGCCAAAATGTTAGCAGAAGCAG
GCGCAACCATACTTGTGGGGACCTGGGTTCCTATCTATAAAATTTTCTCT
CAATCTTTGGAGTTAGGAAAATTCAATGCATCTCGTGAACTCTCCAATGG
AGAATTGCTAACTTTCGCTAAAATCTATCCCATGGATGCCAGTTTCGACA
CCCCAGAAGATATTCCTCAGGAAATTTTGGAAAATAAACGTTACAAAGAT
CTTTCTGGGTACACTGTATCCGAAGTTGTAGAACAGGTGAAAAAACATTT
TGGACACATTGATATTCTTGTTCACTCTTTAGCAAACAGTCCGGAAATTG
CTAAACCATTACTTGATACCTCTCGTAAAGGCTATCTTGCCGCCTTAAGT
ACATCCAGCTACTCCTTTATCAGCCTTCTCTCTCATTTTGGCCCAATTAT
GAATGCAGGAGCTAGCACCATCTCTCTAACTTATCTTGCTTCCATGCGTG
CTGTTCCAGGGTATGGCGGAGGAATGAACGCAGCAAAAGCTGCTTTAGAA
AGTGATACAAAAGTACTGGCTTGGGAAGCCGGCCGACGTTGGGGAGTCCG
AGTGAATACTATCTCGGCAGGGCCATTAGCTAGCCGTGCAGGAAAAGCTA
TTGGATTTATTGAGAGAATGGTGGATTACTACCAAGACTGGGCTCCACTA
CCTTCTCCAATGGAAGCTGAGCAAGTAGGCGCAGCAGCAGCCTTCTTAGT
CTCTCCCCTAGCTAGCGCAATTACGGGAGAAACTCTCTATGTGGATCACG
GAGCCAATGTGATGGGCATAGGTCCAGAAATGTTTCCTAAGGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy