Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR82 IGR81 IGR78 IGR84 IGR79 IGR83 IGR80 rbfA, - CT095 CT101 fabI, - CT104 rs1, - CT098 infB, - CT096 acpS, - CT100 CT102 CT103 trxB, - CT099 rbfA, - CT095 CT101 fabI, - CT104 rs1, - CT098 infB, - CT096 acpS, - CT100 CT102 CT103 trxB, - CT099 rbfA, - CT095 CT101 fabI, - CT104 rs1, - CT098 infB, - CT096 nusA, - CT097 nusA, - CT097 acpS, - CT100 CT102 CT103 trxB, - CT099
* Calculated from Protein Sequence

Gene ID: CT098

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs1  

Definition:
30S ribosomal protein S1

Gene Start:
115674

Gene Stop:
113968

Gene Length:
1707

Molecular Weight*:
63565

pI*:
5.03

Net Charge*:
-20.92

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
Experimental evidence from primer extension analysis of CT098
and its promoter sequence prediction can be found in the reference
(Journal of Bacteriology Vol 177 No 15 P4252-4260)



Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ribosomal protein S1 proteins, e.g., 37% similarity to RS1_ECOLI, 35% similarity to RS1_BUCAP.
CT098 is identical to 551770 (M23000) and 2160696 (U74759), previously published trachomatis 30S RIBOSOMAL PROTEIN S1 (70 KD ANTIGEN) sequences. See Sardinia et al., J. Bacteriol. 171 (1), 335-341 (1989).
CT098 is similar to TP0279 in T.pallidum, a predicted S1 sequence. It is weakly similar
to MG104, a virulence-associated protein in M.genitalium.

CT098 is orthologously related to CPn0315:
residues 1-551 are 90% similar to that of CPn0315.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0539
COG name: Ribosomal protein S1
Functional Class:  J
The phylogenetic pattern of COG0539 is ----YqvCebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 52-70, 134-152, 353-371, 479-497, 220-238, 440-458, 526-544, 70-84, 113-132, 284-303, 137-153, 223-239, 154-171, 183-203, 532-552, 240-261, 413-434, 326-347, 500-521, 318-337, 405-424, 492-511, 232-251, 271-289, 358-376, 445-463, 531-549 are significantly matched to blocks PR00681A,B,C,D,E,F,G,H,I, concerned with ribosomal protein S1 signature proteins, e.g., HIU328016, RS1_MYCLE and RS1_ECOLI.
Residues 468-480 are significantly matched to blocks BL01034B, concerned with glycosyl hydrolases family 16 proteins, e.g., GUB_BACBR.

ProDom Summary:  Protein Domain Search
Residues 145 to 176 constitute a defined 30S ribosomal protein domain in RS1_CHLTR.
Residues 479-546, 395-459 are 37%, 43% similar to a K3 protein domain respectively as seen in IF2A_METJA

Paralogs:  Local Blast Search
CT098 is paralogously related to CT842, a polynucleotide phosphorylase protein: residues 447-537, 205-288, 178-377, 391-455 are 32%, 37%, 25%, 32% similar to CT842.

Pfam Summary:  Pfam Search
Residues 48 to 116 (E-value = 4.9e-17) place CT098 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 130 to 199 (E-value = 1.4e-16) place CT098 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 216 to 288 (E-value = 8.5e-22) place CT098 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 301 to 375 (E-value = 1.6e-25) place CT098 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 388 to 462 (E-value = 7.8e-25) place CT098 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 475 to 548 (E-value = 1.1e-22) place CT098 in the S1 family which is described as S1 RNA binding domain (PF00575)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
38  
119
non-globular  
305  
393
non-globular  
501  
569

PDB Hit:
gi|2098462|pdb|1SRO| S1 Rna Binding Domain, Nmr, 20 Structures S1 Rna-Binding Domain, Polynucleotide Phosphorylase (Pnpase) Mol_id: 1; Molecule: Pnpase; Chain: Null; Fragment: S1 Rna Binding Domain; Synonym: Polyribonucleotide Nucleotidyltransferase, Pol

Gene Protein Sequence:
MPKQADYTWGAKKNLDTIACLPEDVKQFKDLLYAMYGFTATEEEPTSEVH
PGAILKGTVVDISKDFVVVDVGLKSEGVIPMSEFIDSSEGLTVGAEVEVY
LDQTEDDEGKVVLSREKATRQRQWEYILAHCEEGSIVKGQITRKVKGGLI
VDIGMEAFLPGSQIDNKKIKNLDDYVGKVCEFKILKINVDRRNVVVSRRE
LLEAERISKKAELIEQITIGERRKGIVKNITDFGVFLDLDGIDGLLHITD
MTWKRIRHPSEMVELNQELEVIILSVDKEKGRVALGLKQKEHNPWEDIEK
KYPPGKRVRGKIVKLLPYGAFIEIEEGIEGLIHVSEMSWVKNIVDPNEVV
NKGDEVEVVVLSIQKDEGKISLGLKQTKHNPWDNIEEKYPIGLRVTAEIK
NLTNYGAFVELEPGIEGLIHISDMSWIKKVSHPSELFKKGNTVEAVILSV
DKESKKITLGVKQLTPNPWDEIEVMFPVGSDISGVVTKITAFGAFVELQN
GIEGLIHVSELSEKPFAKIEDVLSIGDKVSAKVIKLDPDHKKVSLSIKEF
LVHGGDAGHDAEEESSDRD

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAAAACAAGCTGATTATACTTGGGGAGCAAAAAAGAATCTCGATAC
GATAGCTTGCTTACCAGAAGACGTTAAACAATTTAAAGACCTTCTCTACG
CGATGTATGGCTTCACCGCGACAGAAGAAGAACCCACTAGCGAAGTACAT
CCTGGTGCGATCCTAAAAGGTACAGTTGTTGACATAAGCAAAGACTTTGT
TGTTGTAGATGTCGGCTTAAAATCTGAGGGAGTTATTCCTATGTCTGAGT
TTATCGACTCTTCAGAAGGTTTAACTGTCGGAGCCGAAGTCGAAGTTTAC
CTAGACCAAACTGAGGATGACGAAGGAAAAGTTGTTTTATCCAGAGAAAA
AGCAACAAGACAACGACAATGGGAATACATTCTTGCTCACTGCGAGGAAG
GTTCTATTGTTAAGGGACAAATTACCCGAAAAGTTAAGGGTGGTTTGATC
GTAGATATTGGTATGGAAGCCTTCCTTCCAGGATCCCAAATAGACAATAA
GAAGATCAAGAACTTAGATGATTACGTAGGCAAGGTTTGTGAGTTCAAAA
TTCTCAAAATCAACGTAGATCGTCGGAACGTTGTTGTATCTAGAAGAGAA
CTTCTCGAAGCTGAACGCATTTCTAAGAAAGCAGAGTTGATCGAGCAAAT
CACTATCGGTGAGCGTCGCAAAGGTATCGTTAAGAATATCACAGATTTCG
GAGTATTCTTGGATCTTGATGGCATTGACGGCCTACTCCACATTACAGAC
ATGACATGGAAACGCATTCGTCACCCATCCGAAATGGTTGAACTCAACCA
AGAATTGGAAGTCATCATCCTTAGCGTTGATAAAGAAAAAGGTCGCGTAG
CTCTTGGCCTCAAACAAAAAGAGCATAATCCTTGGGAAGATATTGAGAAG
AAATATCCTCCAGGAAAACGTGTTCGCGGAAAAATTGTTAAACTCCTTCC
TTATGGAGCATTTATTGAAATCGAAGAAGGAATTGAAGGCCTTATTCACG
TTTCAGAGATGTCTTGGGTTAAGAACATTGTAGATCCTAATGAAGTGGTC
AACAAAGGTGATGAAGTCGAAGTAGTTGTTCTTTCTATCCAAAAAGATGA
AGGAAAAATCTCTCTCGGTCTCAAACAAACAAAACACAATCCTTGGGATA
ACATTGAAGAAAAATATCCTATCGGCCTCCGCGTAACAGCAGAAATTAAA
AATCTGACAAACTACGGAGCTTTCGTTGAGTTGGAGCCAGGAATCGAAGG
TTTGATCCATATCTCTGACATGAGTTGGATTAAAAAAGTTTCCCATCCTT
CAGAGCTCTTCAAAAAAGGTAATACCGTCGAAGCAGTTATTCTGTCTGTA
GACAAAGAAAGCAAAAAAATCACTTTGGGCGTGAAACAATTAACTCCTAA
TCCATGGGATGAGATTGAAGTTATGTTCCCTGTCGGAAGTGATATCTCTG
GCGTAGTAACTAAAATTACGGCTTTCGGAGCTTTCGTTGAGTTGCAAAAT
GGTATCGAAGGACTGATCCATGTATCCGAGCTTTCAGAGAAACCTTTTGC
TAAAATTGAAGATGTTCTCTCTATTGGAGACAAAGTTTCTGCTAAAGTTA
TCAAGCTAGACCCAGATCACAAGAAAGTTTCTCTTTCTATTAAAGAGTTC
CTTGTTCATGGGGGAGATGCTGGTCACGATGCGGAAGAAGAATCTTCTGA
CAGAGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy