Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR74 IGR78 IGR76 IGR77 IGR75 rbfA, - CT095 ribF, - CT093 sctU,yscU, - CT091 lcrD,sctV, - CT090 infB, - CT096 ychF, - CT092 rbfA, - CT095 ribF, - CT093 sctU,yscU, - CT091 lcrD,sctV, - CT090 infB, - CT096 ychF, - CT092 rbfA, - CT095 ribF, - CT093 sctU,yscU, - CT091 lcrD,sctV, - CT090 infB, - CT096 truB, - CT094 nusA, - CT097 truB, - CT094 nusA, - CT097 ychF, - CT092
* Calculated from Protein Sequence

Gene ID: CT093

DNA Molecule Name:
1  

Genbank ID:
3328489

Gene Name:
ribF  

Definition:
riboflavin kinase/FAD synthase

Gene Start:
108810

Gene Stop:
107908

Gene Length:
903

Molecular Weight*:
33339

pI*:
6.93

Net Charge*:
-0.30

EC:
2.7.1.26  2.7.7.2  

Functional Class:
cofactor biosynthesis; riboflavin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Riboflavin metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to riboflavin kinase proteins, e.g., residues
19-296 are 35% similar to the kinase from A.aeolicus (AE000675). CT092 is similar to TP0888, a predicted riboflavin kinase in T.pallidum.
It is also similar to MG145 in M.genitalium.

CT093 is orthologously related to CPn0320: residues 2-296 are 48% similar to Cpn0320.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0196
COG name: FAD synthase
Functional Class:  H
The phylogenetic pattern of COG0196 is ----yqvceBrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 187-296 are 41% similar to a kinase domain of RIBF_PSEFL. Residues
44-183 and 130-200 are similar to domains of RIBF_CORAM and ATPL_SHEEP respectively.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 16 to 162 (E-value = 3.3e-60) place CT093 in the Flavokinase family which is described as Riboflavin kinase (Flavokinase) (PF06574)
Residues 178 to 300 (E-value = 1.4e-28) place CT093 in the FAD_Synth family which is described as Riboflavin kinase / FAD synthetase (PF01687)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
198  
232

PDB Hit:
None.

Gene Protein Sequence:
MMQMDLFYSLLPSSNPVESVTIGFFDGCHLGHQALLSFLTKFPSKSGVIT
FSQHPEHTLSNSPPETITSLEERVQLLAGCGIDYLAVLPFNQEIANQEAE
PFIQSIYKTLRPSRIVLGYDSRLGKGGLGTAQTLRPFAASLGISLEEVPP
LQIEGTIVSSRKIRQFLRKKDLCSAEKFLGRPFSYTGKVAHGRGIGASFG
YATINLPLTHSLLPLGVYTCTIVIEGFSYAGVMNLGMAPTMQRHQLCLEA
HILDFSEDLYDKSITVIPEQFLREEKLFSSKDELVLAIQEDIRQARLNKN
R

Gene Nucleotide Sequence:  Sequence Viewer
GTGATGCAAATGGACTTATTCTACAGCCTGCTCCCGTCCTCTAATCCTGT
AGAATCTGTTACTATAGGTTTTTTCGATGGGTGTCATTTAGGACACCAAG
CTTTGCTTTCTTTTTTAACGAAGTTTCCTAGCAAATCTGGAGTAATTACG
TTCAGCCAGCATCCTGAGCATACTTTGTCTAACTCTCCTCCAGAAACTAT
TACCTCTCTTGAGGAGCGTGTTCAGCTTCTGGCTGGCTGCGGCATTGATT
ATCTAGCCGTTCTCCCTTTTAACCAGGAAATAGCTAATCAAGAGGCAGAG
CCATTTATCCAGTCTATTTACAAGACTCTACGTCCATCAAGAATTGTCTT
GGGTTACGATTCTAGACTTGGGAAGGGTGGTTTAGGAACAGCACAAACGT
TAAGGCCTTTTGCTGCCTCTTTAGGGATATCTCTAGAAGAAGTCCCTCCC
CTACAGATTGAAGGTACTATTGTATCTAGCAGAAAAATTCGACAATTTCT
TAGAAAGAAAGATTTGTGCTCTGCAGAAAAGTTTCTTGGGAGACCTTTTT
CTTATACAGGAAAGGTTGCTCATGGACGAGGAATTGGGGCATCTTTTGGA
TATGCAACAATCAATCTTCCCCTTACCCATTCTCTACTTCCTTTAGGGGT
ATATACTTGTACTATCGTTATTGAAGGGTTCAGCTATGCAGGTGTTATGA
ATTTAGGTATGGCGCCCACAATGCAAAGACACCAACTATGCCTAGAGGCA
CATATCCTTGATTTTTCAGAAGATCTCTACGATAAGAGTATTACTGTGAT
TCCTGAGCAATTTCTCAGGGAAGAAAAGCTCTTTTCTTCTAAAGACGAGC
TTGTCCTTGCCATTCAAGAAGATATCCGCCAAGCCCGTCTCAATAAAAAT
AGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy