Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR61 IGR66 IGR67 IGR65 IGR63 IGR62 IGR60 IGR64 CT079 yojL, - CT077 CT073 CT084 recF, - CT074 dnaN, - CT075 ltuB, - CT080 CT081 smpB, - CT076 CT083 CT082 CT079 yojL, - CT077 CT073 CT084 recF, - CT074 dnaN, - CT075 ltuB, - CT080 CT081 smpB, - CT076 CT083 CT082 CT079 yojL, - CT077 CT073 CT084 recF, - CT074 dnaN, - CT075 folD, - CT078 folD, - CT078 CT081 smpB, - CT076 CT083 CT082 ltuB, - CT080
* Calculated from Protein Sequence

Gene ID: CT078

DNA Molecule Name:
1  

Genbank ID:
3328473

Gene Name:
folD  

Definition:
methylenetetrahydrofolate dehydrogenase

Gene Start:
92776

Gene Stop:
91916

Gene Length:
861

Molecular Weight*:
30853

pI*:
7.61

Net Charge*:
2.45

EC:
1.5.1.15  1.5.1.5  

Functional Class:
cofactor biosynthesis; folate  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate

Comment:
This protein, a homodimer in B.subtilis, appears to be necessary for purine, thymidylate,
histidine, pantothenate, methionine and formyl-Met-tRNA synthesis. See CT612, CT613, and CT614.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to methylenetetrahydrofolate dehydrogenase(EC 1.5.1.5) / methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) proteins, e.g., 47% similarity to FOLD_BACSU, 41% similarity to FOLD_ECOLI.
CT078 is similar to TP0732, a predicted folD protein in T.pallidum.
It is also similar to MG013 in M.genitalium.

CT078 is orthologusly related to CPn0335: residues 1-282 are 67%
similar to CPn0335.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0190
COG name: 5,10-methylene-tetrahydrofolate dehydrogenase
Functional Class:  H
The phylogenetic pattern of COG0190 is ----Yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 27-52, 63-114, 134-169, 184-235, 242-279 are significantly matched to blocks BL00766A,B,C,D,E, concerned with tetrahydrofolate dehydrogenase/cyclohydrolase proteins, e.g. C1TM_YEAST and C1TC_YEAST.

ProDom Summary:  Protein Domain Search
Residues 29 to 277 are 51% similar to a methylenetetrahydrofolate dehydrogenase/cyclohydrolase methenyltetrahydrofolate synthase domain as seen in FOLD_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 1 to 114 (E-value = 2.6e-62) place CT078 in the THF_DHG_CYH family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763)
Residues 116 to 286 (E-value = 5.6e-110) place CT078 in the THF_DHG_CYH_C family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882)

PDB Hit:
None.

Gene Protein Sequence:
MLLKGAPAADHILATIKENIRACSKAPGLAVVLIGNNPASEIYVNMKIKR
ATDLGMVSKSYRKPSDATLSDILALIHQLNNDENIHGILVQLPLPKHLDA
QAILSTITPDKDVDGLHPVNVGKLLLGETDGFIPCTPAGIVELCKYYEIP
LHGKHVVILGRSNIVGKPLAALLMQRHADTNASVTLLHSQSEHLTEITRT
ADILISAIGVPLFVNKEMIAEKTVIMDVGTSRIPAANPKGYILVGDVDFN
NVVPVCRAITPVPGGVGPMTVAMLMRNTWESFLRHTS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTATTAAAGGGTGCGCCAGCAGCTGACCATATTTTAGCAACAATCAA
GGAAAATATCCGAGCCTGCTCCAAAGCTCCTGGTCTTGCTGTTGTGTTGA
TAGGAAATAATCCGGCCTCAGAAATCTATGTGAATATGAAAATCAAGCGT
GCTACGGATTTGGGGATGGTGTCTAAATCCTATCGCAAGCCCTCGGATGC
CACACTATCCGACATTTTAGCGCTCATCCACCAACTCAATAATGATGAGA
ACATCCACGGAATCCTTGTTCAACTCCCCCTACCCAAACATTTAGACGCT
CAAGCTATTCTTTCCACTATCACCCCTGACAAAGACGTCGATGGACTACA
CCCTGTCAATGTAGGGAAACTACTTCTTGGAGAAACAGATGGATTTATCC
CATGCACTCCTGCTGGAATTGTGGAACTGTGCAAATATTATGAGATCCCT
CTCCATGGAAAGCACGTTGTTATCTTAGGACGTAGCAATATCGTAGGTAA
ACCTTTAGCGGCCTTACTTATGCAAAGACATGCAGATACTAATGCTAGTG
TCACTCTCCTTCATAGCCAATCTGAGCATCTTACCGAGATCACTAGGACT
GCAGATATTCTCATTTCAGCTATTGGAGTACCGCTCTTTGTAAATAAAGA
GATGATTGCAGAAAAAACGGTGATCATGGATGTCGGTACCTCAAGAATCC
CTGCAGCGAATCCTAAAGGTTATATCCTTGTAGGAGATGTCGATTTTAAC
AATGTTGTACCTGTTTGCCGAGCCATTACTCCTGTCCCTGGTGGAGTCGG
CCCAATGACCGTCGCTATGCTAATGAGAAATACATGGGAAAGTTTTTTGC
GTCATACCTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy