Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR57 IGR58 IGR54 IGR59 IGR55 IGR56 CT066 adt,npt1, - CT065 lepA, - CT064 ytgA,troA, - CT067 CT071 troC/troR,ytgC, - CT069 CT072 CT066 adt,npt1, - CT065 lepA, - CT064 ytgA,troA, - CT067 CT071 troC/troR,ytgC, - CT069 CT072 CT066 adt,npt1, - CT065 lepA, - CT064 ytgA,troA, - CT067 CT071 troC/troR,ytgC, - CT069 CT072 ytgB,troB, - CT068 troD,ytgD, - CT070 ytgB,troB, - CT068 troD,ytgD, - CT070
* Calculated from Protein Sequence

Gene ID: CT068

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ytgB  troB  

Definition:
ABC transport system component; ATP-binding protein

Gene Start:
80699

Gene Stop:
81475

Gene Length:
777

Molecular Weight*:
28943

pI*:
7.15

Net Charge*:
0.59

EC:
 

Functional Class:
transport and binding; general  

Pathway: pathway table
Membrane Transport; ATP-binding cassette (ABC) transport system

Primary Evidence:
Bannantine JP, Rockey DD. 1999. Use of primate model system to identify Chlamydia trachomatis protein antigens recognized uniquely in the context of infection. Microbiology 145(Pt 8):2077-85. Medline: 10463174.

Secondary Evidence:
Cockayne,A., Hill,P.J., Powell,N.B., Bishop,K., Sims,C. and
Williams,P. 1998. Molecular cloning of a 32-kilodalton lipoprotein component of a novel iron-regulated Staphylococcus epidermidis ABC transporter. Infect. Immun. 66(8): 3767-3774. Medline: 98339879.

Bartsevich,V.V. and Pakrasi,H.B. 1995. Molecular identification of an ABC transporter complex for manganese: analysis of a cyanobacterial mutant strain impaired in the photosynthetic oxygen evolution process. EMBO J. 14(9): 1845-1853. Medline: 95262624.

Kolenbrander,P.E., Andersen,R.N. and Ganeshkumar,N. 1994. Nucleotide sequence of the Streptococcus gordonii PK488 coaggregation adhesin gene, scaA, and ATP-binding cassette. Infect. Immun. 62(10) 4469-4480. Medline: 95012638.

Comment:
See CT067, CT069, and CT070. These are pare of a putative manganese ABC transporter.

For a recent review of ABC transporters, please see Nikaido and Hall. 1998. Overview of bacterial ABC transporters. Methods Enzymol 292:3-20. Medline: 9711542. See also, Linton and Higgins, 1998 (Medline: 9593292), Saier et al., 1998 (Medline: 9506471), and Fath and Kolter, 1993 (Medline: 8302219).

For a complete listing of Chlamydia ABC transporters, alignments of transporters, nucleotide binding domain organization,and plasma membrane organization, please go to: http://www.stdgen.lanl.gov, choose Bacteria under the Analysis heading on the left-side navigation frame, then click on the ABC transporters analysis subsection.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to bacterial ABC transporter sequences, e.g. residues 11-244 are 44% similar to a transporter from B. subtilis (Z99119).

CT068 is orthologously related to CPn0348: residues 1-259 are 72% similar to CPn048. CT068 is similar to TP0164 and other ABC transporters in T. pallidum. It is also similar to MG119 in M. genitalium.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1121
COG name: ABC-type iron (III) transport system, ATPase component
Functional Class:  P
The phylogenetic pattern of COG1121 is a-tk-qvCeB-H-----LINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 39-50 and 142-173 are similar to blocks BL00211A,B, which include ABC transporters,
e.g. HMUV_YERPE, YCXD_CYAPA. Residues 36-51 and 155-169 are
similar to disease resistance blocks PR00364A,B.

ProDom Summary:  Protein Domain Search
Residues 186-231 are 54% similar to an ATP-binding domain of YSC1_STRGC.
Residues 11-238 span twelve domains related to ATP-binding.

Paralogs:  Local Blast Search
CT068 is paralogously related to CT416, CT130, CT202, CT180,
CT689, CT152, CT653, CT264, CT685, CT348, CT690, CT201 and CT333,
predicted ABC transporters.

Pfam Summary:  Pfam Search
Residues 34 to 217 (E-value = 3.6e-42) place CT068 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
73

PDB Hit:
None.

Gene Protein Sequence:
MNRDNAIAWSVEDLCVNYDHSDVLCHITFSLPAGAMAAIIGPNGAGKSTL
LKASLGLIRASSGQSLFFGQRFSKVHHRIAYMPQRASVDWDFPMTVLDLV
LMGCYGYKGIWNRISTDDRQEAMRILERVGLEAFANRQIGKLSGGQQQRA
FLARSLMQKADLYLMDELFSAIDMASYQMVVDVLQELKSEGKTIVVIHHD
LSNVRKLFDHVILLNKHLVCSGSVEECLTKEAIFQAYGCELELLDYTLKL
SRGKYQGSC

Gene Nucleotide Sequence:  Sequence Viewer
TTGAATAGAGATAATGCAATTGCTTGGTCCGTAGAGGATCTTTGTGTTAA
TTATGATCACTCAGACGTCTTATGTCACATTACTTTTTCTCTGCCTGCAG
GGGCAATGGCTGCTATTATTGGGCCGAATGGAGCTGGTAAAAGTACTTTG
CTTAAGGCTTCTTTAGGACTGATTCGTGCTTCTTCTGGCCAAAGCTTGTT
CTTTGGTCAGAGATTTTCCAAGGTACATCATAGAATAGCCTATATGCCTC
AAAGAGCGAGTGTGGATTGGGATTTCCCAATGACTGTTCTTGATCTCGTG
TTGATGGGGTGTTACGGCTATAAAGGAATATGGAATCGTATTTCCACTGA
TGATCGTCAGGAGGCTATGCGTATTTTAGAGCGGGTTGGTTTGGAAGCTT
TTGCAAATCGTCAAATAGGTAAGCTCTCTGGAGGACAACAACAGAGAGCT
TTTTTAGCGCGGTCATTAATGCAAAAAGCAGATTTGTATCTCATGGATGA
GCTGTTCTCTGCGATCGATATGGCCTCTTATCAGATGGTTGTAGATGTTT
TGCAAGAGCTTAAAAGCGAAGGGAAGACTATTGTGGTCATTCATCATGAT
TTGAGTAATGTCCGGAAGCTTTTTGATCATGTGATTTTATTAAATAAGCA
TCTTGTGTGCTCTGGAAGCGTAGAAGAATGCTTGACTAAAGAAGCCATTT
TTCAGGCTTATGGGTGTGAACTTGAGCTTTTGGATTACACACTCAAATTG
TCTAGAGGCAAGTACCAAGGATCGTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy