Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR57 IGR58 IGR54 IGR59 IGR55 IGR56 CT066 adt,npt1, - CT065 lepA, - CT064 ytgA,troA, - CT067 CT071 troC/troR,ytgC, - CT069 CT072 CT066 adt,npt1, - CT065 lepA, - CT064 ytgA,troA, - CT067 CT071 troC/troR,ytgC, - CT069 CT072 CT066 adt,npt1, - CT065 lepA, - CT064 ytgA,troA, - CT067 CT071 troC/troR,ytgC, - CT069 CT072 ytgB,troB, - CT068 troD,ytgD, - CT070 ytgB,troB, - CT068 troD,ytgD, - CT070
* Calculated from Protein Sequence

Gene ID: CT067

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ytgA  troA  

Definition:
ABC transporter, probable solute binding protein; adhesin

Gene Start:
79726

Gene Stop:
80703

Gene Length:
978

Molecular Weight*:
37022

pI*:
5.53

Net Charge*:
-6.77

EC:
 

Functional Class:
transport and binding; general  

Pathway: pathway table
Membrane Transport; ATP-binding cassette (ABC) transport system

Primary Evidence:
Bannantine JP, Rockey DD. 1999. Use of primate model system to identify Chlamydia trachomatis protein antigens recognized uniquely in the context of infection. Microbiology 145(Pt 8):2077-85. Medline: 10463174.

Secondary Evidence:
Cockayne,A., Hill,P.J., Powell,N.B., Bishop,K., Sims,C. and
Williams,P. 1998. Molecular cloning of a 32-kilodalton lipoprotein component of a novel iron-regulated Staphylococcus epidermidis ABC transporter. Infect. Immun. 66(8): 3767-3774. Medline: 98339879.

Bartsevich,V.V. and Pakrasi,H.B. 1995. Molecular identification of an ABC transporter complex for manganese: analysis of a cyanobacterial mutant strain impaired in the photosynthetic oxygen evolution process. EMBO J. 14(9): 1845-1853. Medline: 95262624.

Kolenbrander,P.E., Andersen,R.N. and Ganeshkumar,N. 1994. Nucleotide sequence of the Streptococcus gordonii PK488 coaggregation adhesin gene, scaA, and ATP-binding cassette. Infect. Immun. 62(10) 4469-4480. Medline: 95012638.

Comment:
See CT068, CT069, and CT070. These are part of a putative manganese ABC transporter.

TroA in T.pallidum has similarity to periplasmic substrate-binding proteins in Gram-negative organisms and to streptococcal proteins with dual function as substrate binding proteins and adhesins (Gene 197:47-64, 1997). TroA is a zinc-binding protein with a helical backbone.

CT067 appears to be a TroA protein in a cluster (TroBCDR) similar to what is seen in T. pallidum.

For a recent review of ABC transporters, please see Nikaido and Hall. 1998. Overview of bacterial ABC transporters. Methods Enzymol 292:3-20. Medline: 9711542. See also, Linton and Higgins, 1998 (Medline: 9593292), Saier et al., 1998 (Medline: 9506471), and Fath and Kolter, 1993 (Medline: 8302219).

For a complete listing of Chlamydia ABC transporters, alignments of transporters, nucleotide binding domain organization,and plasma membrane organization, please go to: http://www.stdgen.lanl.gov, choose Bacteria under the Analysis heading on the left-side navigation frame, then click on the ABC transporters analysis subsection.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to adhesion protein precursor sequences and to uncharacterized proteins, e.g., 24% similarity to ADHS_STRSA, 22% similarity to ADHS_STRGC, 22% similarity to ADHS_STRPN.
Residues 19-320 are 27% similar to the YtgA sequence from B.subtilis (Z99119). Residues 37-320 are 27% similar to the
TroA sequence from T.pallidum (U16363) (TP0163). No similarity
to M.genitalium.
CT067 is orthologously related to CPn0349: residues 12-326 are 59% similar to CPn0349.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0803
COG name: Zn-binding (lipo)protein of the ABC-type Zn transport system (surface adhesin A)
Functional Class:  P
The phylogenetic pattern of COG0803 is a-tK-QvCeBrH-----LINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 40-58, 71-84, 84-101, 196-217 are significantly matched to blocks PR00690A,B,C,D, concerned with adhesin family signature proteins, e.g., ADHS_STRSA. Residues 40-61, 65-83, 84-103, 138-157, 196-213, 299-317 are significantly matched to blocks PR00691A,B,C,D,E,I, concerned with adhesin B signature proteins, e.g., ADHS_STRSA and SPU407861.

ProDom Summary:  Protein Domain Search
Residues 43 to 279 are 25% similar to an adhesin precursor protein domain as seen in ADHS_STRPA.

Paralogs:  Local Blast Search
CT067 is paralogously related to CT415, also an adhesin: residues 54-267 are 23% similar to CT415.

Pfam Summary:  Pfam Search
Residues 16 to 321 (E-value = 7.9e-130) place CT067 in the SBP_bac_9 family which is described as Periplasmic solute binding protein family (PF01297)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
32

PDB Hit:
none

Gene Protein Sequence:
MSFFHTRKYKLILRGLLCLAGCFLMNSCSSSRGNQPADESIYVLSMNRMI
CDCVSRITGDRVKNIVLIDGAIDPHSYEMVKGDEDRMAMSQLIFCNGLGL
EHSASLRKHLEGNPKVVDLGQRLLNKNCFDLLSEEGFPDPHIWTDMRVWG
AAVKEMAAALIQQFPQYEEDFQKNADQILSEMEELDRWAARSLSTIPEKN
RYLVTGHNAFSYFTRRYLSSDAERVSGEWRSRCISPEGLSPEAQISIRDI
MRVVEYISANDVEVVFLEDTLNQDALRKIVSCSKSGQKIRLAKSPLYSDN
VCDNYFSTFQHNVRTITEELGGTVLE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTTTTTCATACTAGAAAATATAAGCTTATCCTCAGAGGACTCTT
GTGTTTAGCAGGCTGTTTCTTAATGAACAGCTGTTCCTCTAGTCGAGGAA
ATCAACCCGCTGATGAAAGCATCTATGTCTTGTCTATGAATCGCATGATT
TGTGATTGCGTGTCTCGCATAACTGGGGATCGAGTCAAGAATATTGTTCT
GATTGATGGAGCGATTGATCCTCATTCATATGAGATGGTGAAGGGGGATG
AAGACCGAATGGCTATGAGCCAGCTGATTTTTTGCAATGGTTTAGGTTTA
GAGCATTCAGCTAGTTTACGTAAACATTTAGAGGGTAACCCAAAAGTCGT
TGATTTAGGTCAACGTTTGCTTAACAAAAACTGTTTTGATCTTCTGAGTG
AAGAAGGATTCCCTGACCCACATATTTGGACGGATATGAGAGTATGGGGT
GCTGCTGTAAAAGAGATGGCTGCGGCATTAATTCAACAATTTCCTCAATA
TGAAGAAGATTTTCAAAAGAATGCGGATCAGATCTTATCAGAGATGGAGG
AACTTGATCGTTGGGCAGCGCGTTCTCTCTCTACGATTCCTGAAAAAAAT
CGCTATTTAGTCACAGGCCACAATGCGTTCAGTTACTTTACTCGTCGGTA
TCTATCCTCTGATGCGGAGAGAGTGTCTGGGGAGTGGAGATCGCGTTGCA
TTTCTCCAGAAGGGTTGTCTCCTGAGGCTCAGATTAGTATCCGAGATATT
ATGCGTGTAGTGGAGTATATCTCTGCAAACGATGTAGAAGTTGTCTTTTT
AGAGGATACCTTAAATCAAGATGCTTTGAGAAAGATTGTTTCTTGCTCTA
AGAGCGGACAAAAGATTCGTCTCGCTAAGTCTCCTTTATATAGCGATAAT
GTCTGTGATAACTATTTTAGCACGTTCCAGCACAATGTTCGCACAATTAC
AGAAGAATTGGGAGGGACTGTTCTTGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy