Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 IGR52 IGR53 IGR50 IGR51 IGR49 IGR54 IGR55 fer, - CT059 CT066 adt,npt1, - CT065 lepA, - CT064 whiG,rspD,rpoZ, - CT061 tyrS, - CT062 gnd, - CT063 flhA, - CT060 fer, - CT059 CT066 adt,npt1, - CT065 lepA, - CT064 whiG,rspD,rpoZ, - CT061 tyrS, - CT062 gnd, - CT063 flhA, - CT060 fer, - CT059 CT066 adt,npt1, - CT065 lepA, - CT064 whiG,rspD,rpoZ, - CT061 tyrS, - CT062 gnd, - CT063 flhA, - CT060
* Calculated from Protein Sequence

Gene ID: CT063

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gnd  

Definition:
6-phosphogluconate dehydrogenase

Gene Start:
73158

Gene Stop:
74597

Gene Length:
1440

Molecular Weight*:
52624

pI*:
5.20

Net Charge*:
-11.13

EC:
1.1.1.44  

Functional Class:
energy metabolism; pentose phosphate cycle  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle

Secondary Evidence:
Reeves,P. and Stevenson,G. 1989. Cloning and nucleotide sequence of the Salmonella typhimurium LT2 gnd gene and its homology with the corresponding sequence of Escherichia coli K12. Mol. Gen. Genet. 217(1): 182-184. Medline: 89364685.

Miller,R.D., Dykhuizen,D.E. and Hartl,D.L. 1988. Fitness effects of a deletion mutation increasing transcription of the 6-phosphogluconate dehydrogenase gene in Escherichia coli. Mol. Biol. Evol. 5(6): 691-703. Medline: 89126937.

Nasoff,M.S., Baker,H.V. II. and Wolf,R.E. Jr. 1984. DNA sequence of the Escherichia coli gene, gnd, for 6-phosphogluconate dehydrogenase. Gene 27(3): 253-264. Medline: 84237540.

Comment:
6-phosphogluconate dehydrogenase catalyzes the third step in the
hexose monophosphate shunt, the decarboxylating reduction of
6-phosphogluconate to ribulose 5-phosphate.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 6-phosphogluconate dehydrogenase, with about 50% of the hits being to prokaryotes and the other half to eukaryotes. For example, residues 6-471 are 51% similar to 6PGD_HAEIN.

CT063 is orthologously related to CPn0360: residues 5-480 are 65% similar to residues 3-376 of CPn0360. CT063 is similar to TP0331 in T. pallidum a predicted phosphogluconate dehydrogenase. No similarity to M. genitalium.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0362
COG name: 6-phosphogluconate dehydrogenase, family 1
Functional Class:  G
The phylogenetic pattern of COG0362 is ----Y-vceBrh----olin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 8-45, 69-106, 112-159, 166-206, 214-247, 250-302, 316-356, 373-426, 194-247, 427-457 are matched to blocks BL00461A,B,C,D,E,F,G,H,I, concerned with 6-phosphogluconate dehydrogenase proteins, e.g. 6PGD_DROME.
Residues 7-26, 121-147, 175-202 are matched to blocks
BL00895A,C,D, concerned with 3-hydroxyisobutyrate dehydrogenase proteins, e.g. YBBQ_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 66-457 are 53% similar to a 6-phosphogluconate dehydrogenase domain represented by 6PGD_HUMAN.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 4 to 176 (E-value = 4e-110) place CT063 in the NAD_binding_2 family which is described as NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446)
Residues 178 to 472 (E-value = 3.3e-127) place CT063 in the 6PGD family which is described as 6-phosphogluconate dehydrogenase, C-terminal domain (PF00393)

PDB Hit:
gi|999515|pdb|1PGN| 6-phosphogluconate dehydrogenase (6-PGDH) (E.C.1.1.1.44) complexed with coenzyme analogue nicotinamide 8-bromo-adenine dinucleotide phosphate

Gene Protein Sequence:
MAPNTDIGLIGLAVMGKNLVLNMVDHGFSVSVYNRSPAKTEEFLKDHGES
GALQGFTTIQEFVQSLKRPRKIMIMIKAGAPVDEMIASLLPFLEEGDILI
DGGNSYYLDSEQRYVDLKKEGILFVGMGVSGGEEGARKGPSIMPGGNIDA
WPAIAPIFQSIAAQVDGRPCCSWIGTGGAGHFVKAVHNGIEYGDIQLICE
TYEILKTRLNLSLEQIGNIFFEWNQTDLNSYLIGAAAAVLIAKDENGNAI
ASTILDVAGQKGTGRWVAEDAIKAGVPMSLIIESVLARYLSTWKEVRTKA
AQEFPGIPLLCQPPQEASAFIEDVREALYAAKIISYAQGFMLLKQVSQDK
GWDLNLGELALIWRGGCIIQSAFLDKIHQGFENSPEAHSLILQDYFKKVL
FDSETGFRRAVLHAIGSGVAIPCLSSALSFYDGYRTVDSSLFLVQGLRDY
FGAHGYERRDCPRGEFYHTDWLETKKTFRV

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCTCCAAATACAGATATTGGGTTGATTGGTTTGGCCGTGATGGGCAA
AAACCTTGTATTGAACATGGTGGATCATGGTTTTTCTGTTTCTGTCTATA
ACCGAAGTCCGGCGAAAACAGAAGAGTTCTTGAAAGATCATGGAGAGAGT
GGAGCTCTGCAAGGATTTACTACGATTCAAGAGTTTGTTCAATCTTTGAA
GCGTCCTCGTAAGATCATGATCATGATTAAAGCGGGAGCTCCTGTTGATG
AAATGATTGCCTCCCTGCTTCCTTTCTTGGAAGAGGGAGATATTCTCATC
GATGGGGGGAATAGCTATTATTTAGATTCTGAGCAACGCTATGTCGACCT
GAAAAAAGAAGGAATTCTATTTGTTGGGATGGGAGTCTCTGGAGGGGAAG
AGGGGGCTAGAAAAGGGCCTTCCATTATGCCCGGAGGGAATATAGATGCT
TGGCCTGCAATCGCTCCTATCTTTCAATCCATAGCTGCTCAGGTGGATGG
ACGACCCTGTTGCTCTTGGATTGGCACAGGAGGTGCAGGGCATTTTGTTA
AGGCTGTTCACAATGGGATCGAATACGGGGATATCCAGTTAATTTGTGAA
ACATATGAGATTCTTAAGACTCGTCTTAATCTCTCTTTAGAGCAGATAGG
GAATATCTTTTTTGAATGGAATCAAACCGATCTGAATAGCTACCTCATTG
GAGCAGCAGCGGCCGTTTTAATAGCAAAAGATGAGAATGGCAATGCGATT
GCTTCTACGATTCTTGATGTTGCTGGACAGAAGGGGACTGGGCGTTGGGT
CGCAGAGGACGCTATTAAGGCAGGCGTTCCTATGTCCCTAATTATTGAAT
CGGTCTTAGCTCGATACCTTTCGACTTGGAAAGAAGTGCGCACAAAGGCA
GCTCAAGAGTTTCCAGGGATTCCTCTTCTCTGTCAACCTCCACAAGAAGC
TTCTGCCTTCATTGAGGATGTGCGAGAGGCTTTGTATGCAGCTAAGATTA
TCAGTTACGCTCAAGGATTTATGCTGCTGAAGCAGGTCTCTCAAGATAAA
GGATGGGATCTGAATTTAGGTGAGTTAGCTTTGATATGGCGTGGGGGTTG
CATTATACAAAGTGCCTTTTTAGATAAAATTCATCAAGGTTTTGAAAATA
GTCCAGAAGCACACTCTTTGATATTACAAGATTATTTTAAAAAGGTTCTG
TTTGATTCAGAAACAGGTTTCCGGCGAGCTGTTTTGCATGCTATCGGATC
TGGTGTAGCTATTCCTTGCTTATCTTCTGCACTATCTTTTTATGATGGAT
ATCGTACGGTGGATTCATCTTTATTCTTAGTGCAAGGATTAAGAGATTAC
TTTGGAGCTCATGGTTATGAGCGTCGAGACTGTCCTCGAGGGGAGTTTTA
TCATACGGATTGGCTAGAAACCAAGAAAACTTTTAGAGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy