Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Pro-1 IGR52 IGR53 IGR48 IGR50 IGR51 IGR49 IGR54 fer, - CT059 CT058 adt,npt1, - CT065 lepA, - CT064 whiG,rspD,rpoZ, - CT061 tyrS, - CT062 gnd, - CT063 flhA, - CT060 fer, - CT059 CT058 adt,npt1, - CT065 lepA, - CT064 whiG,rspD,rpoZ, - CT061 tyrS, - CT062 gnd, - CT063 flhA, - CT060 fer, - CT059 CT058 adt,npt1, - CT065 lepA, - CT064 whiG,rspD,rpoZ, - CT061 tyrS, - CT062 gnd, - CT063 flhA, - CT060
* Calculated from Protein Sequence

Gene ID: CT062

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tyrS  

Definition:
tyrosyl-tRNA synthetase

Gene Start:
71910

Gene Stop:
73145

Gene Length:
1236

Molecular Weight*:
45423

pI*:
7.09

Net Charge*:
0.28

EC:
6.1.1.1  

Functional Class:
amino acid biosynthesis; aromatic  
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Lam,H.M. and Winkler,M.E. 1992. Characterization of the complex pdxH-tyrS operon of Escherichia coli K-12 and pleiotropic phenotypes caused by pdxH insertion mutations. J. Bacteriol. 174(19): 6033-6045. Medline: 93015640.

Henkin TM, Glass BL, Grundy FJ. 1992. Analysis of the Bacillus subtilis tyrS gene: conservation of a regulatory sequence in multiple tRNA synthetase genes. J Bacteriol. 174(4):1299-306. Medline: 1735721.

Barker,D.G., Bruton,C.J. and Winter,G. 1982. The tyrosyl-tRNA synthetase from Escherichia coli. Complete nucleotide sequence of the structural gene. FEBS Lett. 150(2): 419-423. Medline: 83132295.

Comment:
Tyrosyl-tRNA synthetase is a homodimer and is likely to be
cytoplasmically located. Through similarity it belongs to class-I
aminoacyl-tRNA synthetases.
Reaction: ATP + l-tyrosine + tRNA(tyr) = AMP + pyrophosphate + l-tyrosyl-tRNA(tyr).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to tyrosyl-tRNA synthetases (TyrRS), e.g. residues 4-404 are 41% similar to SYY_ECOLI.

CT062 is orthologously related to CPn0361: residues 1-412 of CT062
are 61% similar to residues 11-422 of CPn0361, a predicted tyrosyl-tRNA synthetase from C. pneumoniae. CT062 is similar to TP0834, a predicted tyr-tRNA synthetase from T. pallidum.
It is also similar to MG455 from M. genitalium.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0162
COG name: Tyrosyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0162 is amtkYqvCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 161-222 are 64% similar to a TYROSYL-TRNA SYNTHETASE domain
represented by SYY_ECOLI.
Residues 33-105, 113-149, 224-252, 348-377 support this assignment.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 22 to 314 (E-value = 7.4e-112) place CT062 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)
Residues 346 to 392 (E-value = 2.9e-08) place CT062 in the S4 family which is described as S4 domain (PF01479)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
41  
68
non-globular  
282  
371

PDB Hit:
gi|230779|pdb|2TS1| Tyrosyl-Transfer RNA Synthetase (E.C.6.1.1.1)

Gene Protein Sequence:
MQQLIDNLKKRGILDNSSAGLESLTVPVSAYLGFDPTAPSLHIGHWIGIC
FLRRLAAYGITPVALVGGATGMIGDPSGKSVERSLLDQAQVLDNSKKIAA
ALASYLPGIRIVNNADWLGSLSMVDFLRDVGKHFRLGSMLAKDVVKQRVY
SEEGISYTEFSYLLLQSYDFAHLFKEHNVVLQCGGSDQWGNITSGIDYIR
RRGLGQAYGLTYPLLTDSKGKKIGKTESGTIWLDPALTPPYELFQYFLRL
PDQEISKVMRTLTLLDNEEIFALDERLTSDPQAVKKYIAEVIVKDVHGSE
GLAQAQAATESFFASKGKSITEAELVALVESGVGVKVARADLIGKRWLDI
VVELGFCSSRGQARRLIQQRGLYINQEPLADEQSILDGTQLCFDRYVLLS
QGKRKKQVIDLN

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACAGTTAATCGATAACCTTAAGAAACGGGGTATTCTAGATAATTC
TTCTGCAGGATTAGAAAGTTTAACAGTTCCTGTTTCTGCCTATTTAGGGT
TCGATCCAACTGCGCCTTCTTTACACATAGGACATTGGATTGGAATTTGT
TTTTTGCGTCGATTAGCAGCATATGGAATCACTCCTGTTGCTCTTGTTGG
CGGAGCTACCGGAATGATCGGAGATCCTTCTGGTAAAAGTGTGGAGCGTT
CATTACTAGATCAGGCACAGGTGCTTGATAATAGTAAGAAAATAGCGGCT
GCTCTTGCTAGCTATCTTCCTGGTATCCGTATTGTGAATAATGCGGATTG
GCTAGGATCTTTAAGTATGGTGGATTTTTTAAGAGATGTTGGGAAGCATT
TTCGTTTAGGTTCTATGTTAGCTAAAGACGTAGTGAAGCAGCGAGTCTAT
TCTGAAGAGGGAATTAGCTACACTGAGTTCAGTTATTTATTGCTGCAGTC
TTATGATTTTGCACATCTCTTTAAAGAGCATAATGTTGTATTACAGTGTG
GAGGGAGTGATCAGTGGGGGAATATTACTTCGGGGATTGATTATATCCGT
CGAAGAGGACTAGGGCAGGCTTATGGTCTAACCTATCCTTTGCTCACTGA
TAGCAAAGGGAAGAAAATAGGGAAGACGGAGTCTGGAACTATCTGGCTGG
ATCCAGCGTTAACTCCTCCTTATGAACTATTCCAATATTTCTTACGCTTG
CCAGATCAAGAAATCTCCAAAGTAATGAGAACTCTTACTCTTTTGGATAA
CGAAGAAATTTTTGCTCTTGATGAGCGTTTGACTAGTGATCCACAAGCTG
TGAAGAAATACATTGCGGAAGTGATCGTTAAAGATGTTCATGGTTCTGAG
GGATTAGCTCAGGCTCAAGCCGCAACCGAAAGCTTTTTTGCTAGTAAGGG
AAAGAGTATTACAGAAGCAGAACTAGTAGCGTTAGTAGAGTCAGGTGTTG
GCGTTAAAGTAGCTCGAGCAGATTTAATAGGGAAACGCTGGTTAGATATC
GTTGTGGAACTAGGCTTTTGTTCCTCAAGAGGACAAGCTAGAAGACTCAT
TCAACAGCGAGGTCTGTACATCAATCAGGAGCCTTTGGCCGATGAACAGA
GTATATTAGACGGGACTCAGTTGTGTTTCGATCGTTATGTTTTGTTGTCC
CAAGGGAAAAGAAAAAAACAAGTGATAGATCTTAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy