Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR44 IGR46 IGR45 IGR42 IGR41 IGR43 CT056 hemN, - CT052 CT051 CT050 CT057 sucB, - CT055 sucA, - CT054 CT056 hemN, - CT052 CT051 CT050 CT057 sucB, - CT055 sucA, - CT054 CT056 hemN, - CT052 CT051 CT050 CT057 CT053 CT053 sucB, - CT055 sucA, - CT054
* Calculated from Protein Sequence

Gene ID: CT054

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sucA  

Definition:
alpha-ketoglutarate dehydrogenase (2-oxoglutarate dehydrogenase; pyruvate dehydrogenase component E1)

Gene Start:
60878

Gene Stop:
63592

Gene Length:
2715

Molecular Weight*:
102912

pI*:
5.28

Net Charge*:
-30.46

EC:
1.2.4.2  

Functional Class:
amino acid biosynthesis; tryptophan, lysine  
central intermediary metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)

Secondary Evidence:
Hein,S. and Steinbuchel,A. 1996. Cloning and characterization of the Alcaligenes eutrophus 2-oxoglutarate dehydrogenase complex. FEMS Microbiol. Lett. 136(3): 231-238. Medline: 97021018.

Darlison,M.G., Spencer,M.E. and Guest,J.R. 1984. Nucleotide sequence of the sucA gene encoding the 2-oxoglutarate dehydrogenase of Escherichia coli K12. Eur. J. Biochem. 141(2): 351-359. Medline: 84236168.

Comment:
See CT055 and CT400. For other pyruvate dehydrogenase components, see CT245, CT246, CT247, CT557.

From GenBank (gi: 2506963): The alpha-ketoglutarate dehydrogenase complex catalyzes the overall conversion of alpha-ketoglutarate to succinyl-CoA and CO2. It contains multiple copies of 3 enzymatic components: alpha-ketoglutarate dehydrogenase E1 (or 2-oxoglutarate dehydrogenase), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3). The reaction is alpha-ketoglutarate + lipoamide = succinyl-dihydrolipoamide + CO2. Thiamine pyrophosphate is a cofactor. In E. coli, this protein is a homodimer.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to alpha-ketoglutarate dehydrogenase sequences, e.g. residues 61-874 are 39% similar to M. tuberculosis (AL021006). Residues 313-478 are 27% similar to MG274, a predicted pyruvate dehydrogenase E1-alpha subunit in M. genitalium.

CT054 is orthologously related to CPn0378 and they share 65% similarity. No similarity to T. pallidum.


COGS Summary:  COGS Search
BeTs to 6 clades of COG0567
COG name: Pyruvate and 2-oxoglutarate dehydrogenases, E1 component
Functional Class:  C
The phylogenetic pattern of COG0567 is ----y---ebrh------inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 321-330 are matched to block BL00392, concerned with
DDC/GAD/HDC/TyrDC pyridoxal-phosphate attachment site proteins,
e.g. DCD1_DROME.

ProDom Summary:  Protein Domain Search
Residues 554-854 are 49% similar to a 2-oxoglutarate dehydrogenase E1 domain, represented by ODO1_ECOLI.

Paralogs:  Local Blast Search
CT054 is weakly related to CT245 (pyruvate dehydrogenase E1 like):
residues 296-475 are 26% similar to CT245.


Pfam Summary:  Pfam Search
Residues 173 to 495 (E-value = 9e-41) place CT054 in the E1_dh family which is described as Dehydrogenase E1 component (PF00676)
Residues 564 to 758 (E-value = 9.4e-58) place CT054 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
283  
342

PDB Hit:
None.

Gene Protein Sequence:
MDSDFARHVHSSDIDWIESLFERFEKHEPMDSSWKYFFEGYQVGKTEGSP
TESSHDQVFTSLQEKKAHSLLMIYRYYGYLQGQVSPISSSEESSLVTEKV
RNFDPQEEIPSLGLLPQSYVRIADFIQVLKEKYCRSIAVETLNCSPEIQE
YIWKLMEGEKPSLTKEVLLARYRDVKRAVAFEEFLQVKFTGQKRFSLEGG
ESLVPMLEHLIACGVKQGINRYVMGMPHRGRLNVLANIFGKPYRQIFMEF
EDAPQIRGLETVGDVKYHKGYVANRPEQNVMMALLPNPSHLESVDPVVEG
AVAAIQHQGEAGKEQACLAVLMHGDAALAGQGVVYETFQLSGIPGYSTEG
TVHIVVNNQMGFTAQPRESRSTPYCTDIAKMMGIPVFRVNGEDILACLQV
MEYAIHIRERFHCDVIIDLCCYRKYGHNESDDPFVTAPFLYEEIKKKKQG
SELFKEILLHHPEWNISSDELERIDTEIAHVLNQEYASLKDPGVERLDKK
ECMHCTRMAAGELLVDNVDTSLDKEALFDLSAKLCDIPEHFSPHAKIRSL
LNKRMSMADGEIGYDWGMAEEVAFASLLQEGFSLRLSGQDSIRGTFSQRQ
LVWTDVQTGDTFSPLYHLSPSQGSVELYNSPLSEYAVLGFEYGYAQQAEK
TLVIWEAQFGDFSNGAQIIFDQYISSGIQKWDLHSDVVVLLPHGYEGQGP
EHSSARIERYLQLASDWNFQVVLPSTPVQYFRILREHTKRDLSLPLIIFS
PKMLLRHPQCVSSIAEFGMKGGFKPFLEDENPNYHAKVLVLCSGKIYYDY
RASLPKDLEYRFACIRVESLYPLYLEDLLVLISKYTEVHHYVWLQEEPQN
MGAFSYFALATDEIFPSKLQCVCRPRSSSTATGSASLSQKELSTLMETLF
SIGRE

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTCAGACTTTGCTAGGCATGTGCATTCATCAGATATTGACTGGAT
AGAATCTTTGTTCGAGCGATTTGAGAAGCATGAGCCGATGGATTCTTCAT
GGAAATATTTCTTTGAAGGTTATCAGGTTGGGAAGACGGAGGGGAGCCCA
ACAGAATCTTCTCATGATCAAGTCTTTACGTCTTTGCAAGAGAAAAAAGC
ACACAGTCTTTTGATGATATACCGTTATTACGGCTATTTACAGGGGCAAG
TGTCTCCAATATCCTCATCAGAAGAATCTTCTCTAGTTACAGAAAAGGTT
CGTAATTTCGATCCTCAAGAAGAGATTCCTTCTTTAGGATTATTACCGCA
ATCTTATGTTCGTATAGCAGACTTTATTCAGGTATTAAAAGAGAAGTATT
GTCGGAGCATCGCTGTTGAGACATTGAATTGCTCTCCTGAGATCCAAGAA
TATATCTGGAAACTCATGGAAGGAGAGAAGCCCTCTTTAACCAAAGAAGT
TCTTCTGGCGCGATATCGAGACGTAAAAAGAGCAGTAGCTTTTGAAGAAT
TTTTACAGGTTAAATTCACAGGACAAAAGCGCTTTTCTCTAGAAGGTGGA
GAGAGCTTGGTTCCCATGTTGGAGCATCTCATTGCTTGTGGGGTTAAGCA
AGGCATCAATCGTTACGTGATGGGAATGCCTCATCGAGGCCGATTAAACG
TTCTTGCTAACATTTTTGGAAAGCCTTACCGGCAGATTTTCATGGAGTTT
GAAGACGCTCCCCAAATAAGAGGGCTGGAAACTGTCGGTGATGTAAAGTA
CCACAAGGGATATGTTGCCAATAGGCCGGAACAGAACGTTATGATGGCTT
TATTGCCGAATCCGAGCCATTTAGAGTCCGTGGATCCTGTTGTGGAAGGT
GCTGTAGCAGCGATTCAACATCAGGGAGAGGCTGGGAAGGAGCAAGCCTG
CTTAGCTGTGTTGATGCATGGAGATGCAGCCTTGGCGGGTCAGGGCGTTG
TATATGAAACTTTCCAGTTGAGTGGGATACCAGGTTATTCAACAGAAGGA
ACTGTGCATATTGTAGTGAATAATCAGATGGGTTTCACTGCGCAGCCTCG
AGAGTCTCGTTCTACTCCTTATTGTACAGATATAGCTAAAATGATGGGGA
TCCCTGTATTCCGAGTGAATGGAGAGGATATTTTAGCCTGTCTCCAGGTC
ATGGAGTATGCTATACATATCCGTGAGCGTTTTCATTGTGATGTGATTAT
CGACCTCTGTTGTTATCGAAAATACGGTCACAATGAAAGTGACGATCCTT
TTGTTACAGCTCCATTTTTATACGAAGAGATCAAAAAGAAAAAACAAGGG
TCAGAATTATTCAAAGAGATCCTTTTACACCATCCTGAATGGAACATTTC
TTCCGACGAGTTGGAGAGAATAGACACAGAGATAGCGCATGTTTTAAACC
AGGAGTACGCTTCTCTGAAAGATCCAGGTGTCGAACGGCTAGATAAAAAA
GAATGTATGCATTGCACTCGTATGGCAGCTGGAGAGCTTCTTGTCGATAA
TGTGGATACATCGTTAGACAAAGAAGCCTTGTTTGATCTGAGTGCCAAAC
TTTGTGATATTCCTGAGCATTTTTCTCCTCATGCAAAGATTCGATCTTTA
TTAAATAAGCGTATGAGCATGGCTGATGGAGAGATCGGTTATGATTGGGG
AATGGCTGAAGAGGTGGCGTTCGCTTCTTTATTACAAGAAGGTTTTTCAT
TACGTTTGTCAGGACAAGATTCTATTCGTGGAACTTTCAGTCAACGACAG
TTAGTCTGGACGGATGTCCAGACAGGGGATACATTCTCTCCATTATATCA
CTTGTCTCCGAGTCAAGGCAGCGTGGAATTATACAATTCCCCTCTATCTG
AATACGCCGTTTTAGGCTTTGAATATGGTTATGCACAACAAGCAGAAAAG
ACTCTTGTTATTTGGGAAGCGCAGTTTGGAGACTTTTCCAATGGAGCCCA
AATCATTTTTGACCAATATATTTCTTCCGGAATTCAGAAATGGGATTTAC
ATTCCGATGTAGTTGTACTGCTTCCTCATGGCTATGAGGGGCAAGGACCT
GAGCATTCCTCGGCTCGTATAGAGCGTTATTTACAGCTCGCTTCCGATTG
GAATTTTCAAGTTGTTCTTCCTTCTACTCCCGTACAGTATTTTCGTATTC
TGCGGGAGCATACGAAGAGAGACCTCTCTCTTCCTCTTATCATTTTTTCT
CCTAAGATGTTATTGCGGCATCCGCAGTGCGTGAGTTCTATCGCAGAGTT
TGGAATGAAGGGAGGCTTCAAGCCTTTCTTGGAAGACGAGAATCCTAACT
ATCATGCAAAAGTTCTTGTTCTTTGTAGTGGCAAGATTTATTACGACTAT
CGTGCTTCTCTTCCTAAAGATCTTGAATATCGTTTTGCTTGTATACGAGT
AGAGAGTTTGTATCCGTTATACTTAGAAGATCTATTGGTTCTGATAAGCA
AATATACGGAAGTTCACCATTATGTATGGTTGCAAGAAGAACCTCAAAAT
ATGGGCGCTTTTAGTTATTTTGCATTAGCAACTGACGAGATTTTCCCTAG
CAAATTGCAGTGCGTTTGCCGTCCTAGGAGTAGTTCAACGGCAACAGGAT
CTGCGAGTTTAAGTCAAAAAGAATTATCGACGTTAATGGAAACCTTGTTT
TCTATAGGTAGAGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy