Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR44 IGR42 IGR40 IGR41 IGR43 hemN, - CT052 CT051 CT050 sucB, - CT055 CT049 sucA, - CT054 hemN, - CT052 CT051 CT050 sucB, - CT055 CT049 sucA, - CT054 hemN, - CT052 CT051 CT050 CT053 CT053 sucB, - CT055 CT049 sucA, - CT054
* Calculated from Protein Sequence

Gene ID: CT052

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemN  

Definition:
oxygen-independent coproporphyrinogen III oxidase

Gene Start:
60110

Gene Stop:
58977

Gene Length:
1134

Molecular Weight*:
42444

pI*:
6.94

Net Charge*:
-0.47

EC:
1.-.-.-  1.3.3.3  

Functional Class:
cofactor biosynthesis; heme and porphyrin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism

Secondary Evidence:
Lieb C, Siddiqui RA, Hippler B, Jahn D, Friedrich B. 1998. The Alcaligenes eutrophus hemN gene encoding the oxygen-independent coproporphyrinogen III oxidase, is required for heme biosynthesis during anaerobic growth. Arch Microbiol 169(1):52-60. Medline: 9396835.

Homuth,G., Heinemann,M., Zuber,U. and Schumann,W. 1996. The genes of lepA and hemN form a bicistronic operon in Bacillus subtilis.
Microbiology 142(Pt 7): 1641-1649. Medline: 96303504.

Troup B, Hungerer C, Jahn D. 1995. Cloning and characterization of the Escherichia coli hemN gene encoding the oxygen-independent coproporphyrinogen III oxidase. J Bacteriol 177(11):3326-31. Medline: 7768836.

Xu K, Elliott T. 1994. Cloning, DNA sequence, and complementation analysis of the Salmonella typhimurium hemN gene encoding a putative oxygen-independent coproporphyrinogen III oxidase. J Bacteriol 176(11):3196-203. Medline: 8195073.

Comment:
Required for anaerobic conversion of coproporphyrinogen III
to protoporphyrinogen-IX as part of porphyrin biosynthesis. This enzyme is the last step in heme biosynthesis in E. coli. See CT745, CT746, and CT747.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to oxygen-independent coproporphyrinogen III
oxidase sequences,e.g. residues 5-372 are 22% similar to HEMN_SALTY.

CT052 is orthologous to CPn0380: residues 1-374 are 64% similar to CPn0380. It is similar to CPn0889, a paralog. CT052 is similar to TP0186, a predicted coproporphyrinogen III oxidase in T. pallidum. No similarity to M. genitalium.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0635
COG name: Coproporphyrinogen III oxidase and related FeS oxidoreductases
Functional Class:  H
The phylogenetic pattern of COG0635 is -----QvCEBrhUJ--olINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 11-33, 8-30, 162-174, 180-192, 159-172 are matched to blocks BL01278D,E,F,G, concerned with Uncharacterized protein family UPF0004 proteins, e.g. Y269_HELPY.

ProDom Summary:  Protein Domain Search
Residues 90-201 are 40% similar to a probable oxygen-independent coproporphyrinogen III oxidase domain, represented by HEMN_BACSU.
Residues 8-84, 232-271 support this assignment.
Residues 68-194 are 26% similar to a hypothetical protein MJ0486
domain represented by Y486_METJA.
Residues 16-142 are 24% similar to a hypothetical protein MJ0103
domain represented by Y103_METJA.



Paralogs:  Local Blast Search
CT052 is paralogously related to CT746 (coproporphyrinogen III
oxidase oxidoreductase): residues 6-285 are 24% similar to CT746.

Pfam Summary:  Pfam Search
Residues 10 to 179 (E-value = 3.1e-28) place CT052 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)
Residues 252 to 360 (E-value = 1.3e-23) place CT052 in the HemN_C family which is described as HemN C-terminal region (PF06969)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
71  
121

PDB Hit:
None.

Gene Protein Sequence:
MNGKTPLALYIHIPFCSKKCHYCSFYTIPYKEELMRSYCEAVIKEGLKKL
APLRCSHYIDTVFFGGGTPSLVPPALIQDILVALEAQHATEITLEANPEN
LSLEYIQALALTSINRISIGVQTFNDPLLKLLGRTHSSSKAIEAFMLCSQ
YGFSNVSADLIYGLPTQSISDFIVDLHQAISLPIQHISIYNLTIDPHTSF
YKHRKRILPSIADDDSLAEMALAAEELLENQGFTRYELASYAKNQAASKH
NTYYWTAKPFLGLGVSASQYLHGIRSKNLSRISHYLRAAHQHLPTLESME
ELPPNERIKETLALRLRLCDPIPFGVFPQELIDEILMHPSIGSLFTKDDK
AFSLNKKGRLFHDSIAEEIMASSFSFSK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGGTAAGACTCCCTTAGCTCTTTACATACATATCCCTTTCTGCTC
GAAGAAATGTCATTATTGTAGTTTCTATACGATCCCGTATAAAGAAGAGT
TAATGCGCTCTTATTGTGAAGCTGTCATTAAAGAGGGGCTAAAAAAACTA
GCCCCTCTACGTTGTTCTCACTATATTGATACAGTATTCTTTGGAGGAGG
GACTCCTTCTTTAGTTCCCCCTGCTTTGATTCAAGATATTCTCGTAGCTC
TAGAAGCTCAGCATGCCACAGAAATCACTCTTGAAGCAAACCCTGAAAAT
CTTTCTCTGGAGTATATCCAGGCTCTCGCCTTGACCTCGATCAATCGCAT
TAGCATTGGCGTACAAACATTCAATGATCCCCTACTTAAGCTACTAGGAC
GCACACACTCTTCATCTAAAGCGATTGAAGCCTTTATGCTCTGCTCCCAA
TACGGATTTTCTAATGTGTCTGCAGACCTTATTTATGGCCTCCCTACACA
GTCGATTAGTGATTTTATTGTTGATCTTCACCAAGCTATTTCTCTCCCAA
TCCAACACATCTCTATTTATAATCTAACTATAGACCCTCACACCTCCTTT
TACAAACACCGTAAACGTATTCTTCCATCCATAGCAGATGACGACTCCCT
AGCTGAGATGGCACTAGCAGCCGAAGAGCTACTAGAGAATCAAGGATTTA
CTCGCTATGAACTTGCTTCCTATGCAAAAAACCAAGCGGCTTCTAAACAC
AATACCTACTACTGGACAGCTAAGCCTTTCTTAGGATTAGGAGTTTCTGC
CTCACAATATCTCCATGGCATTCGATCCAAAAACCTTTCTAGGATCTCGC
ATTACTTACGAGCTGCGCATCAACATCTACCGACTTTAGAGTCTATGGAA
GAGCTCCCTCCAAACGAACGCATTAAAGAGACTCTAGCTTTGCGCCTCCG
TCTCTGCGACCCCATCCCCTTTGGAGTTTTCCCTCAGGAACTCATAGACG
AAATATTAATGCACCCGTCTATAGGTTCTCTATTTACTAAGGATGACAAA
GCTTTTTCATTAAATAAAAAAGGGCGTCTTTTTCATGATTCTATAGCAGA
AGAAATCATGGCTTCTTCTTTTTCATTTTCAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy