Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR40 IGR32 IGR39 IGR38 IGR33 IGR36 IGR37 IGR35 IGR34 CT043 glgX, - CT042 ssb, - CT044 hctB, - CT046 yabC1, - CT048 CT041 CT047 CT049 carP,xerB,pepA, - CT045 CT043 glgX, - CT042 ssb, - CT044 hctB, - CT046 yabC1, - CT048 CT041 CT047 CT049 carP,xerB,pepA, - CT045 Type: tandem, Name:  - 1 CT043 glgX, - CT042 ssb, - CT044 hctB, - CT046 yabC1, - CT048 CT041 CT047 CT049 carP,xerB,pepA, - CT045
* Calculated from Protein Sequence

Gene ID: CT045

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
carP  xerB  pepA  

Definition:
Leucyl aminopeptidase

Gene Start:
49866

Gene Stop:
51362

Gene Length:
1497

Molecular Weight*:
54167

pI*:
5.85

Net Charge*:
-4.66

EC:
3.4.11.1  

Functional Class:
translation; proteases  

Pathway: pathway table

Secondary Evidence:
"XERB, AN ESCHERICHIA-COLI GENE REQUIRED FOR PLASMID COLE1 SITE-SPECIFIC
RECOMBINATION, IS IDENTICAL TO PEPA, ENCODING AMINOPEPTIDASE-A, A PROTEIN
WITH SUBSTANTIAL SIMILARITY TO BOVINE LENS LEUCINE AMINOPEPTIDASE." 1989.
STIRLING CJ, COLLOMS SD, COLLINS JF, SZATMARI G, SHERRATT DJ. EMBO JOURNAL
8(5): 1623-1627.

Comment:
From Prosite PDOC00548:

Cytosol aminopeptidase is a eukaryotic cytosolic zinc-dependent exopeptidase that catalyzes the removal of unsubstituted amino-acid residues from the N-terminus of proteins. This enzyme is often known as leucine aminopeptidase (EC 3.4.11.1) (LAP) but has been shown to be identical with prolyl aminopeptidase (EC 3.4.11.5). Cytosol aminopeptidase is a hexamer of identical chains, each of which binds two zinc ions.

Cytosol aminopeptidase is highly similar to Escherichia coli pepA, a manganese dependent aminopeptidase. Residues involved in zinc ion-binding in the mammalian enzyme are absolutely conserved in pepA where they presumably bind manganese.

A cytosol aminopeptidase from Rickettsia prowazekii and one from Arabidopsis thaliana also belong to this family.

The activity is activated by manganese and inhibited by zinc and EDTA.
Believed to be a homohexamer.

Blast Summary:  PSI-Blast Search
CT045 is similar to a previously published C.trachomatis protein (M86605).
Other hits in gapped BLAST to leucine aminopeptidase sequences,
e.g. residues 34-496 are 36% similar to AMPL_RICPR. Residues 87-468 are
35% similar to MG391, a predicted aminopeptidase from M.genitalium. No similarity
to T.pallidum or M.genitalium.

CT045 is orthologously related to CPn0385: residues 1-499 of CT045 are 71%
similar to residues 1-499 of CPn0385, a predicted leucyl aminopeptidase from C. pneumoniae.


COGS Summary:  COGS Search
BeTs to 9 clades of COG0260
COG name: Leucyl aminopeptidase
Functional Class:  E
The phylogenetic pattern of COG0260 is -----q-cEbrHujgp--inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 260-275, 316-356, 428-468, 230-270, 368-383, 412-435, 439-452, 455-471
are matched to blocks BL00631A,B,C,D,E,F, concerned with cytosol
aminopeptidase protein sequences, e.g. YA55_SCHPO.

ProDom Summary:  Protein Domain Search
Residues 179-466 are 42% similar to a cytosol aminopeptidase (LAP)
domain represented by AMPL_RICPR.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 179 to 491 (E-value = 1.4e-147) place CT045 in the Peptidase_M17 family which is described as Cytosol aminopeptidase family, catalytic domain (PF00883)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
161  
267
transmembrane  
291  
318

PDB Hit:
gi|1127256|pdb|1LCP|A Chain A, Molecule: Leucine Aminopeptidase; Chain: A, B; Ec: 3.4.11.1; Heterogen: L-Leucine Phosphonic Acid

Gene Protein Sequence:
MVLLYSQASWDKRSKADALVLPFWMKNSKAQEAAVVDEDYKLVYQNALSN
FSGKKGETAFLFGNDHTKEQKIVLLGLGKSEEVSGTTVLEAYAQATTVLR
KAKCKTVNILLPTISQLRFSVEEFLTNLAAGVLSLNYNYPTYHKVDTSLP
FLEKVTVMGIVSKVGDKIFRKEESLFEGVYLTRDLVNTNADEVTPEKLAA
VAKDLAGEFASLDVKILDRKAILKEKMGLLAAVAKGAAVEPRFIVLDYQG
KPKSKDRTVLIGKGVTFDSGGLDLKPGKAMITMKEDMAGAATVLGIFSAL
ASLELPINVTGIIPATENAIGSAAYKMGDVYVGMTGLSVEIGSTDAEGRL
ILADAISYALKYCNPTRIIDFATLTGAMVVSLGESVAGFFANNDVLARDL
AEASSETGEALWRMPLVEKYDQALHSDIADMKNIGSNRAGSITAALFLQR
FLEDNPVAWAHLDIAGTAYHEKEELPYPKYATGFGVRCLIHYMEKFLSK

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTATTACTCTATTCTCAAGCGAGTTGGGATAAACGATCAAAAGCGGA
TGCTCTTGTTCTTCCTTTTTGGATGAAGAATTCTAAAGCTCAAGAAGCTG
CGGTTGTTGATGAGGACTACAAGCTTGTCTATCAAAACGCATTATCCAAT
TTTTCAGGGAAGAAAGGGGAAACGGCTTTTCTTTTTGGAAATGATCACAC
AAAAGAACAAAAAATTGTTCTTCTTGGTCTAGGGAAGAGCGAAGAAGTAT
CCGGAACAACCGTTTTAGAAGCCTACGCTCAGGCTACTACTGTTTTAAGA
AAAGCTAAGTGTAAGACTGTAAATATTTTACTCCCAACAATTTCACAGTT
GCGCTTCTCCGTAGAAGAGTTTTTAACGAACTTGGCAGCAGGGGTGCTAT
CTCTGAACTATAATTACCCAACCTATCACAAAGTGGATACGTCTTTGCCT
TTCCTAGAGAAAGTGACTGTAATGGGTATTGTCTCTAAGGTAGGGGACAA
GATCTTTAGAAAAGAAGAGAGCCTATTTGAAGGGGTATATTTAACTAGAG
ATTTAGTGAATACCAATGCAGATGAAGTCACTCCAGAAAAACTTGCTGCG
GTAGCAAAAGATCTAGCAGGGGAGTTCGCGAGTCTGGATGTAAAAATTCT
AGATAGGAAGGCGATATTAAAAGAAAAAATGGGATTGTTGGCTGCTGTTG
CCAAGGGCGCTGCTGTTGAGCCTCGGTTTATTGTTCTGGATTACCAAGGT
AAACCTAAATCTAAAGATAGAACCGTACTCATTGGTAAAGGGGTAACATT
CGATTCCGGAGGACTAGATTTGAAACCTGGGAAGGCAATGATTACCATGA
AGGAAGACATGGCTGGAGCGGCTACCGTTCTAGGAATTTTTTCTGCTTTA
GCTTCCTTAGAGCTTCCGATCAATGTGACCGGGATCATTCCAGCTACAGA
GAATGCAATTGGATCGGCTGCCTATAAGATGGGAGATGTATATGTTGGAA
TGACCGGCCTTTCTGTAGAAATTGGCAGCACTGATGCGGAAGGGCGTTTG
ATTTTAGCAGATGCCATCTCCTATGCTTTGAAATATTGTAATCCTACCCG
CATCATTGACTTTGCTACCTTGACGGGTGCTATGGTTGTTTCTTTAGGAG
AATCTGTGGCTGGATTTTTTGCAAATAACGACGTGTTGGCAAGAGATCTA
GCAGAAGCTTCATCAGAGACCGGGGAAGCTCTATGGAGAATGCCTTTGGT
AGAGAAATATGACCAGGCACTTCATTCAGATATTGCAGATATGAAAAATA
TCGGCAGCAATCGTGCAGGATCGATTACTGCAGCGCTATTTTTACAACGT
TTCCTCGAAGACAATCCAGTAGCATGGGCACATTTGGACATTGCAGGTAC
TGCTTACCATGAAAAAGAAGAGTTGCCTTACCCCAAATATGCAACAGGAT
TTGGTGTGCGTTGTTTAATTCATTATATGGAGAAATTCCTATCTAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy