Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR28 IGR30 IGR31.1 IGR32 IGR31 IGR33 IGR36 IGR29 IGR35 IGR34 CT038 CT037 CT043 dcd, - CT039 CT036 glgX, - CT042 CT039.1 ssb, - CT044 hctB, - CT046 ruvB, - CT040 carP,xerB,pepA, - CT045 CT038 CT037 CT043 dcd, - CT039 CT036 glgX, - CT042 CT039.1 ssb, - CT044 hctB, - CT046 ruvB, - CT040 carP,xerB,pepA, - CT045 Type: tandem, Name:  - 1 CT038 CT043 dcd, - CT039 CT036 glgX, - CT042 CT037 CT039.1 ssb, - CT044 hctB, - CT046 ruvB, - CT040 carP,xerB,pepA, - CT045 CT041 CT041
* Calculated from Protein Sequence

Gene ID: CT042

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glgX  

Definition:
glycogen debranching protein

Gene Start:
47965

Gene Stop:
45968

Gene Length:
1998

Molecular Weight*:
76068

pI*:
5.98

Net Charge*:
-15.21

EC:
3.2.1.-  

Functional Class:
energy metabolism; starch and sucrose metabolism  

Pathway: pathway table
Nucleotide Metabolism; Aminosugars metabolism

Secondary Evidence:
Romeo T, Kumar A, Preiss J. 1996. Analysis of the Escherichia coli glycogen gene cluster suggests that catabolic enzymes are encoded among the biosynthetic genes. Gene 70(2):363-76. Medline: 2975249.

Jeanningros R, Creuzet-Sigal N, Frixon C, Cattaneo J. 1976. Purification and properties of a debranching enzyme from Escherichia coli. Biochim Biophys Acta 438(1):186-99. Medline: 779849.

Comment:
See CT866.

A debranching enzyme can also be called an alpha-dextranase. This enzyme hydrolyzes alpha(1->6) and alpha(1->4) bonds. Glycogen is highly branched with branch points occuring every 8 to 12 glucose residues.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to starch debranching enzymes
and to glycogen operon protein GlgX sequences, e.g. residues 11-619
are 42% similar to D90908. No similarities to T.pallidum or M.genitalium.
CT042 is orthologously related to CPn0388: residues 1-660 are 62% similar to CPn0388.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1523
COG name: Pullulanase and related glycosidases
Functional Class:  G
The phylogenetic pattern of COG1523 is ------vCebrh------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 251-262, 323-334 are matched to blocks PR00110B,C,
concerned with Alpha-amylase signatures,e.g. AM2A_ORYSA.

ProDom Summary:  Protein Domain Search
Residues 345-556 are 50% similar to a Glycogen operon protein GLGX homolog
domain represented by GLGX_MYCTU; residues 26-134, 175-318, 393-438, 482-555
support this assignment.


Paralogs:  Local Blast Search
CT042 is paralogously related to CT866(1,4-alpha-glucan branching
enzyme, residues 25-332 are 22% similar to CT866.

Pfam Summary:  Pfam Search
Residues 13 to 101 (E-value = 1.8e-18) place CT042 in the Isoamylase_N family which is described as Isoamylase N-terminal domain (PF02922)
Residues 148 to 555 (E-value = 1.4e-15) place CT042 in the Alpha-amylase family which is described as Alpha amylase, catalytic domain (PF00128)

PDB Hit:
gi|230754|pdb|2TAA|A Chain A, Taka-Amylase A (E.C.3.2.1.1)

Gene Protein Sequence:
MESLSVRSTIPLPLGAKKLSADRYRFSLFSSQAQQVTLVLLDPLSEIHEI
PLSSTDHRTGAIWHIEIAGISSEWSYAYKLRGTDLSSQKFATDSYIADPY
SKNIYSPQLFGSPKQEKDYAFSYLKHEDFDWEGDTPLHLPKENYFIYEMH
VRSFTRDPSSQVSHPGTFLGIIEKIDHLKQLGVHAVELLPIFEFDETVHP
FKNQDFPHLCNYWGYSSVNFFCPSRRYTYGADPCAPAREFKTLVKALHRA
GIEVILDVVFNHTGFEGTSCPLPWIDLESYYMVNDHGDLMNFSGCGNTVN
TNTPTTLKWILDALRYWVQEMHVDGFRFDLASVFSRDPQGVPLPLTPILQ
AISSDSILSETKLIAEPWDAGGLYQLGHFPSISTRWSEWNGCYRDHVKAF
LNGDAHQVSSFASRISGSHDIYPNGKPTNSINYICSHDGFTLYDTVAYND
KHNEENGEYNRDGTSANYSYNFGCEGETTDPTICALRERQMKNFFLALFL
SQGIPMIQSGDEYGHTAYGNNNHWCLDTKINYFLWDRLAERKELFSFLCQ
VIALRKAYTELFNTSFLSEDTITWLNTKGSPREWGADHYLAFELKHLNYS
LFVAFYSGNERIEISLPKPRKEHLAYEKIVDSTTGFFSQILSPKLSLEPY
SSLVAISRRKTSLESR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAATCTTTGTCTGTTCGTTCCACTATCCCTTTACCTCTAGGAGCCAA
AAAGCTCTCCGCTGATCGCTACCGTTTTTCTCTATTTTCTTCACAAGCCC
AGCAGGTTACTCTTGTACTATTAGACCCTCTTTCTGAAATTCATGAAATT
CCTCTATCTTCTACCGACCACAGGACTGGAGCCATCTGGCATATCGAAAT
TGCAGGCATTTCTAGTGAATGGTCGTATGCTTATAAACTACGTGGTACAG
ACTTGAGCTCTCAAAAGTTTGCTACAGATTCTTACATCGCAGACCCTTAT
TCTAAGAATATCTACTCCCCTCAACTATTTGGATCCCCTAAACAAGAAAA
GGATTACGCATTTAGTTACCTGAAACATGAGGATTTTGACTGGGAAGGCG
ACACTCCTTTGCACCTTCCAAAAGAAAATTACTTCATTTATGAAATGCAT
GTTCGGTCATTCACCCGAGATCCGTCTTCCCAGGTTTCCCATCCTGGAAC
TTTCCTTGGTATTATCGAAAAAATAGACCACCTCAAACAACTAGGCGTTC
ATGCAGTTGAACTCCTTCCTATTTTCGAATTCGATGAAACCGTCCATCCA
TTTAAAAATCAGGACTTCCCCCACCTGTGTAACTATTGGGGGTATTCTTC
GGTGAATTTTTTCTGCCCCTCTCGCCGTTATACTTATGGGGCAGACCCTT
GCGCTCCGGCCCGAGAGTTCAAGACTCTTGTCAAAGCATTACACCGTGCG
GGAATCGAAGTCATTCTCGATGTCGTTTTCAATCATACAGGCTTTGAAGG
CACAAGCTGCCCTCTTCCCTGGATAGATCTAGAATCCTATTATATGGTCA
ATGATCATGGGGATCTCATGAATTTCTCCGGGTGTGGTAATACAGTCAAT
ACCAACACCCCCACTACTCTGAAATGGATTCTTGATGCTTTGCGGTACTG
GGTACAGGAAATGCACGTAGATGGATTTCGTTTTGATTTAGCCTCAGTCT
TCTCTAGAGATCCACAAGGAGTCCCTCTCCCTTTAACCCCCATTTTGCAA
GCTATATCCTCTGATTCCATTTTATCAGAAACTAAACTGATCGCTGAACC
TTGGGACGCTGGAGGTTTGTATCAGCTTGGACACTTCCCCTCTATATCAA
CCCGATGGAGCGAGTGGAATGGATGCTACCGTGACCATGTAAAAGCCTTC
CTGAATGGAGATGCTCATCAAGTAAGTTCCTTTGCTTCACGAATATCTGG
ATCTCATGACATCTATCCCAATGGGAAACCTACGAACTCGATTAACTATA
TCTGCTCTCATGATGGCTTCACACTCTACGATACTGTTGCCTATAACGAT
AAGCACAATGAAGAGAATGGTGAATACAATCGTGATGGGACTTCAGCAAA
CTATAGCTATAACTTTGGCTGCGAAGGAGAAACGACAGATCCCACCATTT
GCGCTCTACGTGAACGCCAAATGAAAAACTTCTTTCTTGCTCTCTTTTTA
TCTCAAGGAATTCCCATGATACAATCCGGAGATGAATATGGGCACACAGC
TTATGGAAATAATAATCACTGGTGCTTAGACACAAAGATCAATTACTTTC
TTTGGGATCGATTAGCTGAAAGGAAAGAACTGTTTTCTTTCTTATGCCAA
GTCATTGCTCTGCGCAAAGCTTATACCGAATTATTCAATACCTCTTTCTT
ATCAGAAGATACGATTACCTGGCTAAATACAAAAGGTTCTCCCAGAGAGT
GGGGAGCCGATCATTATCTAGCTTTTGAGTTGAAACACCTGAACTACAGT
TTATTCGTAGCGTTTTATAGTGGGAATGAACGTATTGAGATCTCTTTACC
TAAACCTAGAAAAGAACATTTGGCCTATGAAAAAATTGTAGATAGCACAA
CAGGATTCTTTTCTCAGATATTATCTCCCAAACTCTCTCTTGAACCTTAT
AGCTCTTTGGTAGCCATCAGCAGAAGAAAAACCTCCTTGGAATCTAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy