Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR28 IGR30 IGR31.1 IGR32 IGR31 IGR33 IGR29 IGR26 IGR27 CT038 CT037 CT043 dcd, - CT039 CT034 CT036 glgX, - CT042 recD, - CT033 CT039.1 bpl, - CT035 ruvB, - CT040 CT038 CT037 CT043 dcd, - CT039 CT034 CT036 glgX, - CT042 recD, - CT033 CT039.1 bpl, - CT035 ruvB, - CT040 CT038 CT037 CT043 dcd, - CT039 CT034 CT036 glgX, - CT042 recD, - CT033 CT039.1 bpl, - CT035 ruvB, - CT040 CT041 CT041
* Calculated from Protein Sequence

Gene ID: CT039

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dcd  

Definition:
deoxycytidine triphosphate deaminase

Gene Start:
43803

Gene Stop:
43234

Gene Length:
570

Molecular Weight*:
21399

pI*:
4.65

Net Charge*:
-6.99

EC:
3.5.4.13  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; pyrimidines  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Secondary Evidence:
Krogan NJ, Zaharik ML, Neuhard J, Kelln RA. 1998. A combination of three mutations, dcd, pyrH, and cdd, establishes thymidine (Deoxyuridine) auxotrophy in thyA+ strains of Salmonella typhimurium. J Bacteriol 180(22):5891-5. Medline: 9811646.

Estevenon AM, Kooistra J, Sicard N. 1995. An Escherichia coli strain deficient for both exonuclease V and deoxycytidine triphosphate deaminase shows enhanced sensitivity to ionizing radiation. Mol Gen Genet 246(4):514-8. Medline: 7891665.

Beck CF, Eisenhardt AR, Neuhard J. 1975. Deoxycytidine triphosphate deaminase of Salmonella typhimurium. Purification and characterization. J Biol Chem 250(2):609-16. Medline: 234434.

O'Donovan GA, Edlin G, Fuchs JA, Neuhard J, Thomassen E. 1971. Deoxycytidine triphosphate deaminase: characterization of an Escherichia coli mutant deficient in the enzyme. J Bacteriol 105(2):666-72. Medline: 5541540.

Comment:
This enzyme converts dCTP to dUTP. It is thought to be a homotetramer.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to deoxycytidine triphosphate deaminase
sequences, e.g. residues 1-188 are 59% similar to the enzyme from Helicobacter
pylori(AE000554). No similarities to T.pallidum or M.genitalium.

CT039 is orthologously related to CPn0392: residues
1-190 are 82% similar to CPn0392.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0717
COG name: Deoxycytidine deaminase
Functional Class:  F
The phylogenetic pattern of COG0717 is aMTk-q-ce-rhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 88-126 are 41% similar to a Deoxycytidine triphosphate
deaminase domain, represented by DCD_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
None.

Gene Protein Sequence:
MGIKEDNWIRKMAIEEGMIEPFADSQVKLHPETGEKLISYGLSSYGYDLR
ISREFKVFTNVYNSLVDPKCFTEDALISIVDDVCIIPPNSFALARSVEYF
RIPRNVLTVCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISNTTPLPAKV
YANEGIAQVLFFEGDATCDVSYAERQGKYQKQQGITIPFV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGATTAAGGAAGATAACTGGATTCGCAAAATGGCAATCGAAGAAGG
TATGATAGAGCCTTTTGCAGACAGTCAAGTGAAACTGCATCCAGAGACTG
GAGAAAAACTCATTAGCTACGGCTTGTCAAGTTATGGGTATGATCTACGC
ATATCGAGAGAATTCAAAGTCTTCACCAATGTGTACAATTCACTTGTCGA
TCCGAAATGTTTTACAGAAGATGCGCTGATTTCCATCGTGGATGATGTTT
GTATTATTCCTCCTAACTCCTTTGCTTTAGCTCGCAGCGTGGAATATTTT
CGTATCCCTCGTAATGTCCTTACTGTGTGTATTGGGAAGTCAACCTACGC
ACGTTGTGGATTGATTGTGAATGTCACTCCTTTTGAACCTGAGTGGGAAG
GATACGTAACTATCGAGATTTCCAATACTACTCCACTTCCAGCGAAAGTC
TATGCTAATGAAGGGATCGCGCAAGTGCTCTTCTTTGAAGGAGATGCTAC
TTGTGATGTATCTTATGCAGAACGCCAAGGGAAATATCAAAAACAACAAG
GGATTACTATTCCGTTTGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy