Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR28 IGR30 IGR31.1 IGR31 IGR25 IGR29 IGR26 IGR27 CT038 CT037 dcd, - CT039 CT034 CT036 recD, - CT033 CT039.1 bpl, - CT035 ruvB, - CT040 metG, - CT032 CT038 CT037 dcd, - CT039 CT034 CT036 recD, - CT033 CT039.1 bpl, - CT035 ruvB, - CT040 metG, - CT032 CT038 CT037 dcd, - CT039 CT034 CT036 recD, - CT033 CT039.1 bpl, - CT035 ruvB, - CT040 metG, - CT032 CT041 CT041
* Calculated from Protein Sequence

Gene ID: CT035

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bpl  

Definition:
biotin-protein ligase

Gene Start:
40354

Gene Stop:
41124

Gene Length:
771

Molecular Weight*:
28633

pI*:
6.04

Net Charge*:
-5.21

EC:
6.3.4.-  6.3.4.10  6.3.4.11  6.3.4.15  6.3.4.9  

Functional Class:
translation; protein modification  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Biotin metabolism

Secondary Evidence:
Bower S, Perkins J, Yocum RR, Serror P, Sorokin A, Rahaim P, Howitt CL, Prasad N, Ehrlich SD, Pero J. 1995. Cloning and characterization of the Bacillus subtilis birA gene encoding a repressor of the biotin operon. J Bacteriol 177(9):2572-5. Medline: 7730294.

Comment:
Biotin-protein ligase is involved in post translational modification of specific proteins through attachment of biotin. For a general discussion of bacterial biotin-proteins, see Fall et al., 1975 (Medline: 235315).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Biotin-protein ligase sequences,
e.g. residues 4-220 are 36% similar to BPL1_YEAST. No similarities
to T.pallidum or M.genitalium.

CT035 is orthologously related to CPn0128: residues 3-247 of CT035 are
56% similar to residues 5-249 of CPn0128, a predicted biotin-protein ligase
from C. pneumoniae.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 4-220 are 37% similar to a Biotin-protein ligase
domain represented by BPL1_YEAST.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
84  
191

PDB Hit:
None.

Gene Protein Sequence:
MKRILVYSDRGVSPYYLRHTVRWLKQVAAPFQMEVCRVNGRFLIHEPLWE
ETTQLLVIPGGADVPYHNVLHGLGTARIDNYVREGGCYLGICAGAYFGCA
QFEFLEPTGSLFVAKRDLGFFPGAANGPVYESAFSYTSSSGVLAAPLVFA
DFPGESFSLFNGGCCFENAEHFPEICIEARYNNLLGKPAAIVSRRLDKGL
VVLSGPHIEYLPEFCSLQEDNVIQAREQIAAHSSSLEEYKQFLIHRLLSN
VVEHVLY

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCGTATCTTAGTGTATTCGGATAGAGGAGTTTCTCCTTACTATTT
GCGCCATACTGTTCGCTGGTTGAAGCAGGTAGCTGCTCCATTCCAGATGG
AGGTATGTCGCGTGAATGGACGTTTCTTGATTCATGAGCCTCTTTGGGAA
GAAACAACCCAGCTTCTTGTAATTCCAGGAGGTGCTGATGTACCTTATCA
TAATGTGTTGCATGGACTGGGGACAGCGCGTATCGATAACTACGTAAGAG
AGGGAGGCTGTTACCTAGGTATTTGCGCAGGAGCTTATTTTGGTTGCGCG
CAGTTTGAATTTCTAGAGCCTACAGGATCTTTATTTGTTGCTAAGCGAGA
TTTAGGTTTTTTCCCGGGAGCTGCTAATGGTCCTGTTTATGAAAGCGCCT
TTTCTTATACAAGTTCCTCTGGAGTTTTAGCCGCTCCACTAGTTTTCGCT
GATTTTCCTGGAGAGAGTTTCTCTCTTTTTAATGGGGGATGCTGTTTCGA
AAATGCGGAACATTTCCCCGAAATATGCATCGAGGCGCGCTATAATAATC
TTCTTGGAAAACCTGCAGCTATTGTCTCCAGACGCCTCGATAAGGGGCTA
GTCGTGCTTTCTGGTCCTCATATAGAGTACCTCCCAGAGTTTTGCTCCTT
GCAAGAAGATAATGTTATTCAGGCGAGAGAGCAAATTGCAGCGCATTCTT
CGAGTCTAGAGGAGTACAAGCAGTTCTTAATCCATCGCCTATTGAGTAAT
GTCGTCGAGCACGTTTTGTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy