Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR24 IGR28 IGR22 IGR23 IGR25 IGR26 IGR27 CT037 CT034 CT036 recD, - CT033 CT031 rl19, - CT028 rnhB, - CT029 bpl, - CT035 trmD, - CT027 metG, - CT032 CT037 CT034 CT036 recD, - CT033 CT031 rl19, - CT028 rnhB, - CT029 bpl, - CT035 trmD, - CT027 metG, - CT032 CT037 CT034 CT036 recD, - CT033 rnhB, - CT029 bpl, - CT035 trmD, - CT027 metG, - CT032 gmk, - CT030 gmk, - CT030 CT031 rl19, - CT028
* Calculated from Protein Sequence

Gene ID: CT033

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recD  

Definition:
exodeoxyribonuclease V alpha subunit

Gene Start:
38742

Gene Stop:
36505

Gene Length:
2238

Molecular Weight*:
83737

pI*:
8.75

Net Charge*:
15.26

EC:
3.1.11.5  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Secondary Evidence:
Finch,P.W., Storey,A., Brown,K., Hickson,I.D. and Emmerson,P.T. 1986. Complete nucleotide sequence of recD, the structural gene for the alpha subunit of Exonuclease V of Escherichia coli. Nucleic Acids Res. 14(21): 8583-8594. Medline: 87066730.

Comment:
In H. influenzae and E. coli, this enzyme manifests a range of exonucleolytic and endonucleolytic activities including ATP-dependent exonucleases and DNA-dependent ATPases. It consists of three subunits, RecB, RecC and RecD; see CT639 and CT640 for two the beta and gamma subunits.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to exodeoxyribonuclease alpha chain (recD) sequences,
e.g. residues 344-708 are 27% similar to EX5A_ECOLI. These tend to be over
the C-terminal residues. Similarity to a conjugation transfer protein of B.subtilis (Z99117):
residues 84-724 are 33% similar to this protein. No similarities to T.pallidum
or M.genitalium.

CT033 is orthologously related to CPn0123, a predicted RecD exodeoxyribonuclease V alpha subunit: residues 5-730 are 58% similar to residues 2-726 of CPn0123.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0507
COG name: ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member
Functional Class:  L
The phylogenetic pattern of COG0507 is -m--Y---ebrh----o-IN-
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 347-362 are matched to block PR00819B, concerned with
CBXX/CFQX Superfamily signatures,e.g. BCSP5KGEN.
Residues 347-362, 447-461, 41-55 are matched to blocks PR00364A,B,C,
concerned with disease resistant protein sequences, e.g. A54809

ProDom Summary:  Protein Domain Search
Residues 341-510 are 33% similar to a DNA helicase domain
represented by DDA_BPT4. Residues 653-698 support this assignment.
Residues 344-701 are 25% similar to a probable conjugal transfer protein TRAA
domain represented by TRAA_RHISN.
Residues 556-709 are 29% similar to an exodeoxyribonuclease V
alpha chain domain represented by EX5A_HAEIN, residues 380-475
support this assignment.

Paralogs:  Local Blast Search
CT033 is weakly paralogous to CT652, RecBCD recombinase subunit RECD - SFI
superfamily): residues 285-704 are 24% similar to CT652.
C

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
216  
271
non-globular  
277  
407

PDB Hit:
none

Gene Protein Sequence:
MGCEEKLSGILELILPEDPLSDQTGYAFLRVPYKNSLVTVCGHLPLSLFK
IGSSVDLTGHWSVDASGALVFRFTSAATYSPDSGIIAYLNAQIKGVGPKL
AQKIVSTFREDTLTVLDSCPSKLVEVDGISPARCEDFSKQLQEQRDLRHA
LLFLQRHGIAIHYGLRLYKKYQNQTIEKVCQDPFLLAKEMYGIGFKTADL
IATCLGVPLNSPNRIVAGIQYSLDELQEEGHTCYPLNDFIVLVEKLLNEE
APEEIIRKEEIRTQIHFLSRQKTVYVKELEQDTYIWSRQLFLAEQQIAID
IRRLLFSSKRIRSINTQEAILEVENLLDLKLEEKQKEALHASSSQKIHII
SGGPGTGKSTIIRAILSIFEKISSPKKIILAAPTGKAAKRMTEITGKRTQ
TIHSLLQYDFKTLSFRKNHEDPIDCDLVIVDESGMIDTILLQRFLAALPD
HAILILIGDVHQLPSVGPGNVLKDLILSHHIEVTYLTKIFRQLQNSNIIT
NAHKVNQGEFPVLNSSSGKKDFLFFQKEDPEEAIKHIIHLVSDFVPKKFG
IFTKDIQVLAPMRKGVLGILNLNRELKAALNPNKLFIQGKFHSFSTGDRV
MQTRNNYNKEVFNGDIGYVTSIDLSTKSLIVCVDGRYISYSQAELNDLIP
AYATSIHKYQGSETSCIILPIHTSHYVMLYRNLLYTAITRGKKLVILVGT
KKAVAIAVRNNKVQHRCTGLQQAMHSLLNKPTPLFSPYTICRPSLG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTTGTGAAGAGAAACTTTCCGGTATTTTGGAGCTGATCCTGCCAGA
AGATCCCCTGTCCGATCAAACAGGGTACGCCTTCCTACGAGTCCCTTACA
AAAATTCACTAGTAACTGTTTGTGGCCATCTCCCGCTCTCTTTGTTCAAA
ATCGGCTCCTCTGTAGACTTAACAGGTCATTGGAGTGTAGATGCTAGCGG
AGCATTAGTGTTTCGCTTTACCTCCGCTGCAACCTATAGTCCTGATTCCG
GAATCATAGCTTACCTGAATGCTCAAATCAAAGGCGTAGGCCCCAAACTT
GCTCAAAAAATTGTCTCAACCTTCAGGGAAGACACGTTAACAGTACTCGA
TTCCTGTCCTTCTAAATTGGTAGAAGTAGATGGGATTTCTCCTGCCCGCT
GCGAAGATTTTTCTAAGCAACTCCAAGAGCAAAGAGACCTACGTCATGCT
TTGTTATTTCTACAACGACATGGAATAGCCATTCATTATGGTTTACGGCT
GTATAAAAAATACCAAAATCAAACGATCGAGAAGGTCTGTCAAGATCCCT
TTCTGCTTGCAAAGGAAATGTACGGTATAGGTTTTAAAACCGCTGATCTT
ATTGCTACGTGCTTAGGAGTCCCTCTAAATTCCCCTAATCGTATCGTTGC
TGGAATTCAATACTCTCTAGATGAACTTCAAGAAGAAGGGCATACCTGCT
ACCCTCTTAATGATTTTATTGTTCTCGTAGAAAAACTGTTGAATGAAGAA
GCTCCAGAGGAGATCATACGGAAAGAGGAAATCCGTACCCAAATCCATTT
CTTGTCACGCCAGAAGACAGTCTATGTCAAGGAACTCGAACAAGATACCT
ATATTTGGTCGCGCCAACTTTTTCTAGCTGAACAACAAATTGCGATTGAT
ATTCGAAGACTCTTGTTTTCTTCTAAACGAATACGATCTATCAATACCCA
GGAAGCGATTCTGGAGGTTGAAAATCTTCTGGATTTGAAATTAGAAGAAA
AACAAAAAGAAGCTCTTCATGCCAGCTCTTCACAAAAGATTCATATTATA
TCTGGGGGACCAGGAACAGGAAAAAGTACAATTATACGTGCTATCCTTTC
TATCTTTGAAAAGATCTCCTCCCCTAAGAAAATAATCCTAGCAGCACCTA
CAGGAAAAGCTGCGAAACGTATGACAGAAATCACAGGGAAACGTACTCAA
ACTATCCACTCTCTTCTCCAGTATGATTTCAAAACCTTGTCATTTCGAAA
GAATCACGAAGATCCTATTGATTGTGATCTTGTTATTGTCGATGAATCTG
GAATGATCGACACCATTCTCTTACAACGCTTTCTAGCTGCACTGCCTGAT
CATGCTATCCTAATTCTAATTGGAGATGTGCACCAGCTTCCCAGCGTAGG
CCCTGGTAATGTCCTTAAAGATCTTATTCTTTCCCATCACATCGAGGTAA
CCTACCTAACGAAAATCTTCCGTCAGTTGCAAAATTCGAATATCATTACA
AATGCCCATAAAGTAAACCAAGGAGAATTCCCGGTTCTCAACAGCTCTTC
AGGGAAAAAAGACTTTTTATTTTTTCAAAAAGAAGACCCTGAAGAAGCGA
TTAAACACATCATTCATCTCGTTTCGGATTTTGTTCCTAAAAAATTTGGT
ATCTTTACCAAAGATATTCAAGTCCTTGCTCCCATGAGAAAAGGGGTATT
AGGAATACTCAATCTAAATAGAGAGTTAAAAGCAGCACTTAATCCTAATA
AACTGTTTATCCAAGGGAAATTTCACTCCTTCTCTACGGGAGATCGCGTT
ATGCAAACGCGTAATAACTATAATAAAGAGGTATTCAACGGAGATATCGG
TTATGTGACCTCTATTGACCTATCTACAAAGAGTTTGATCGTTTGCGTGG
ATGGCCGCTATATTAGTTATTCGCAAGCAGAACTCAATGACCTGATACCA
GCTTATGCTACTTCCATACACAAATACCAAGGAAGTGAGACCTCCTGTAT
TATTCTTCCTATTCACACCTCTCATTACGTGATGCTGTATAGAAACTTAC
TCTATACAGCAATTACACGAGGGAAAAAACTAGTCATTTTAGTAGGAACA
AAGAAAGCAGTTGCTATTGCTGTTCGTAATAATAAGGTTCAACACCGATG
TACCGGGCTGCAACAAGCTATGCACTCCCTTCTTAACAAACCAACTCCTC
TTTTCTCTCCTTACACTATTTGTAGACCGTCTCTAGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy