Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR24 IGR21 IGR22 IGR23 IGR25 IGR26 IGR27 CT034 recD, - CT033 CT031 rl19, - CT028 rnhB, - CT029 bpl, - CT035 trmD, - CT027 ffh, - CT025 metG, - CT032 CT034 recD, - CT033 CT031 rl19, - CT028 rnhB, - CT029 bpl, - CT035 trmD, - CT027 ffh, - CT025 metG, - CT032 CT034 recD, - CT033 rl19, - CT028 rnhB, - CT029 bpl, - CT035 trmD, - CT027 ffh, - CT025 metG, - CT032 rs16, - CT026 gmk, - CT030 rs16, - CT026 gmk, - CT030 CT031
* Calculated from Protein Sequence

Gene ID: CT032

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
metG  

Definition:
methionyl-tRNA synthetase

Gene Start:
34710

Gene Stop:
36359

Gene Length:
1650

Molecular Weight*:
62674

pI*:
4.98

Net Charge*:
-18.57

EC:
6.1.1.10  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Methionine metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Kim S, Jo YJ, Lee SH, Motegi H, Shiba K, Sassanfar M, Martinis SA. 1998. Biochemical and phylogenetic analyses of methionyl-tRNA synthetase isolated from a pathogenic microorganism, Mycobacterium tuberculosis. FEBS Lett. 427(2):259-62. Medline: 9607323.

Lee SW, Jo YJ, Kim S. 1998. Cloning and characterization of mitochondrial methionyl-tRNA synthetase from a pathogenic fungi Candida albicans. Gene. 215(2):311-8. Medline: 9714830.

Kim SJ, Kim S. 1997. Temperature sensitivity of a class I tRNA synthetase induced by artificial breakage of polypeptide chain. Mol Cells 7(3):389-93. Medline: 9264027.

Schmitt E, Panvert M, Mechulam Y, Blanquet S. 1997. General structure/function properties of microbial methionyl-tRNA synthetases. Eur J Biochem. 246(2):539-47. Medline: 9208948.

Comment:
See CT209.

Methionyl-tRNA synthetase is probably essential for cell survival,
being required not only for elongation of protein synthesis but alsofor the initiation of all mRNA translation through initiator
tRNA(fmet) aminoacylation. Reaction: ATP + l-methionine + tRNA(met) = AMP + pyrophosphate + l-methionyl-tRNA(met). Its cofactor is a zinc ion. It is a homodimer and is located cytoplasmically. Methionyl-tRNA synthetase has strong similarity to cysteinyl-tRNA synthetase and belongs to class-I aminoacyl-tRNA synthetases.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to methionyl-tRNA synthetase
sequences, e.g., residues 4-539 are 32% similar to the enzyme
from M. thermoautotrophicum (AE000841).

CT032 is orthologously related to CPn0122: residues 5-550 of CT032
are 68% similar to residues 4-551 of CPn0122, a predicted
methionyl-tRNA synthetase from C. pneumoniae. CT032 is similar to TP0798 in T. pallidum and to MG021 in M. genitalium, both predicted met-tRNA synthetases.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0143
COG name: Methionyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0143 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 13-23 and 329-338 have matches to blocks BL00178A,B,
which encompass aminoacyl-tRNA synthetase sequence, e.g., SYIM_YEAST and SYC_SYSNY3.

ProDom Summary:  Protein Domain Search
Residues 20-127 are 43% similar to a met-tRNA synthetase domain
represented by SYM_HUMAN. Residues 10-108, 140-206, 256-276,
276-457, and 382-458 also match well-defined domains
supporting this assignment.

Paralogs:  Local Blast Search
CT032 is weakly related to CT209, thought to be a leucyl-tRNA
synthetase: residues 50-187 are 28% similar to this protein.

Pfam Summary:  Pfam Search
Residues 2 to 371 (E-value = 3.6e-10) place CT032 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

PDB Hit:
gi|443121|pdb|1MEA| Methionyl-Trna Synthetase (E.C.6.1.1.10) (Zinc Binding Domain, Residues 138-163) (Nmr, Minimized Average Structure)

Gene Protein Sequence:
MESSRILITSALPYANGPLHFGHITGAYLPADVYARFQRLQGKEVLYICG
SDEYGIAITLNAELAGMGYQEYVDMYHKLHKDTFKKLGISVDFFSRTTNT
YHPAIVQDFYRNLQERGLVENQVTEQLYSEEEGKFLADRYVVGTCPKCGF
DRARGDECQQCGADYEARDLKEPRSKLTGAALSLRDTEHAYLHLERMKED
LLAFVQGIYLRPHMRNFVTDYIEHLRPRAVTRDLSWGIPVPDLENKVFYV
WFDAPIGYISGTMDWAASIGDPEAWKKFWLDDTVTYAQFIGKDNTSFHAA
IFPAMEIGQSLPYKKVDALVTSEFLLLEGFQFSKSDGNFIDMDAFLETYS
LDKLRYVLAAIAPETSDSEFSFQEFKTRCNSELVGKYGNFVNRVLAFAVK
NGCTELSSPQLEQKDLDFISKSQKLAKDAAEHYAQYSLRKACSTIMELAA
LGNGYFNDEAPWKLAKEGNWNRVRAILFCACYCQKLLALISYPIMPETAL
KILEMIAPHSLDLGSQDPDRLQSLWTDSFFDYSEEKFSLKEPELLFTMVE


Gene Nucleotide Sequence:  Sequence Viewer
GTGGAATCTTCCCGTATTCTTATTACTTCTGCGTTGCCTTACGCAAATGG
TCCTTTGCATTTTGGACATATTACCGGTGCTTATTTGCCTGCAGATGTTT
ATGCGCGTTTTCAGAGACTACAAGGCAAAGAGGTCTTGTATATTTGTGGT
TCTGATGAATACGGAATCGCAATTACCCTTAATGCAGAGTTGGCAGGCAT
GGGGTATCAAGAATATGTCGACATGTATCATAAGCTTCATAAAGATACCT
TCAAGAAATTGGGAATTTCTGTAGATTTCTTTTCCAGAACTACGAACACT
TATCATCCTGCTATTGTGCAAGATTTCTATCGAAACTTGCAGGAACGCGG
ACTGGTAGAGAATCAGGTGACCGAACAGCTGTATTCTGAGGAAGAAGGGA
AGTTTCTAGCGGACCGTTATGTTGTAGGTACTTGTCCCAAGTGTGGGTTC
GATCGAGCTCGAGGAGATGAGTGTCAGCAGTGCGGTGCCGATTACGAAGC
TAGAGATCTGAAAGAGCCTCGTTCTAAATTAACGGGGGCAGCTTTATCTT
TACGTGATACGGAACATGCTTACTTGCATTTGGAGCGCATGAAAGAAGAT
TTGCTTGCTTTCGTGCAAGGTATTTATCTACGTCCTCATATGCGTAATTT
CGTTACGGATTACATCGAGCATTTACGTCCTCGAGCAGTGACTCGAGATT
TGTCTTGGGGAATACCCGTTCCTGATTTGGAAAATAAGGTATTCTATGTA
TGGTTCGATGCTCCAATTGGTTACATAAGTGGAACTATGGATTGGGCAGC
ATCGATTGGAGACCCTGAAGCTTGGAAGAAGTTTTGGTTGGACGATACTG
TGACCTACGCACAGTTTATAGGTAAAGATAATACTTCTTTCCATGCGGCT
ATTTTCCCTGCTATGGAAATAGGACAATCTCTTCCCTATAAGAAAGTGGA
TGCTCTTGTAACATCAGAATTTTTATTGTTAGAAGGTTTCCAGTTCAGTA
AATCGGATGGGAATTTTATAGACATGGATGCGTTTTTAGAAACGTATTCC
TTGGATAAACTGCGTTATGTGTTGGCAGCGATTGCTCCAGAGACTTCGGA
TAGCGAATTCTCTTTCCAAGAGTTCAAGACGCGATGCAATTCTGAGCTTG
TAGGGAAGTATGGAAATTTTGTGAATCGAGTTCTAGCTTTTGCTGTTAAG
AATGGATGCACAGAGCTTTCTTCTCCTCAATTAGAGCAAAAGGATTTGGA
TTTTATCTCAAAATCTCAAAAACTTGCTAAGGATGCAGCCGAACATTACG
CACAATACAGTTTGCGTAAGGCGTGTTCCACGATTATGGAATTAGCTGCT
TTAGGGAATGGCTATTTCAATGATGAAGCTCCATGGAAATTGGCTAAAGA
GGGTAACTGGAATCGGGTACGCGCTATTCTATTCTGTGCTTGTTACTGCC
AGAAGTTGCTAGCTCTCATTTCCTATCCTATTATGCCTGAAACAGCATTG
AAGATTTTGGAAATGATAGCTCCACATTCCTTAGATCTAGGTTCCCAAGA
TCCAGATAGATTACAATCTCTTTGGACAGATTCCTTTTTTGATTACTCGG
AAGAGAAATTTTCTCTGAAAGAGCCTGAATTATTGTTCACAATGGTAGAG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy