Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR24 IGR21 IGR22 IGR23 IGR25 IGR26 CT034 recD, - CT033 CT031 rl19, - CT028 rnhB, - CT029 hemK,yfcB, - CT024 trmD, - CT027 ffh, - CT025 metG, - CT032 CT034 recD, - CT033 CT031 rl19, - CT028 rnhB, - CT029 hemK,yfcB, - CT024 trmD, - CT027 ffh, - CT025 metG, - CT032 CT034 recD, - CT033 rl19, - CT028 rnhB, - CT029 hemK,yfcB, - CT024 trmD, - CT027 ffh, - CT025 metG, - CT032 rs16, - CT026 gmk, - CT030 rs16, - CT026 gmk, - CT030 CT031
* Calculated from Protein Sequence

Gene ID: CT030

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gmk  

Definition:
guanylate kinase

Gene Start:
33798

Gene Stop:
34412

Gene Length:
615

Molecular Weight*:
23094

pI*:
5.69

Net Charge*:
-4.64

EC:
2.7.4.8  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; purines  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism

Secondary Evidence:
Gentry D, Bengra C, Ikehara K, Cashel M. 1993. Guanylate kinase of Escherichia coli K-12. J Biol Chem 268(19):14316-21. Medline: 8390989.

Comment:
This protein is identical to GenBank accession AAC67620 (genome position accession AE001277). In prokaryotes(such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids.

Blast Summary:  PSI-Blast Search
CT030 is orthologusly related to CPn0120: residues 3-201 are 62% similar to CPn0120.

Hits in gapped BLAST to Guanylate kinase protein sequences, e.g. residues 20-203 are 44% similar to KGUA_ECOLI. Residues 19-198 are 35% similar to MG107, a predicted 5' guanylate kinase. No similarity to T. pallidum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0194
COG name: Guanylate kinase
Functional Class:  F
The phylogenetic pattern of COG0194 is ----yqvcEbrhujgp--inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 22-34, 50-70, 78-125, are matched to blocks BL00856A,B,C,
concerned with Guanylate kinase protein sequences, e.g. KGUA_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 79-147 are 44% similar to a Guanylate kinase(GMP kinase)
domain represented by KGUA_HELPY, residues 34-76 support
this assignment.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 54 to 157 (E-value = 1.3e-27) place CT030 in the Guanylate_kin family which is described as Guanylate kinase (PF00625)

PDB Hit:
gi|494043|pdb|1GKY| Guanylate Kinase (E.C.2.7.4.8) Complex With Guanosine Monophosphate

Gene Protein Sequence:
MSVKVISPFSQDGVQCFPKLFIISAPAGAGKTTLTHMLQREFPDAFEKTV
SSTTRSARPGEVHGVDYLFVSEDDFKQSLDREDFLEWVFLFGTYYGTSKA
EISRVLQKGKHCIAVIDVQGALALKKQMPAVTIFIQAPSQEELERRLNAR
DSEKDFQKKERLEHSAVEIAAASEFDYVVVNDDLITAYQVLRSIFIAEEH
RMSHG

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGTAAAGGTTATTTCCCCCTTTTCTCAAGACGGGGTTCAATGCTT
TCCCAAGCTTTTTATCATTAGCGCTCCTGCTGGAGCAGGGAAGACAACAC
TCACCCATATGCTACAAAGAGAGTTTCCTGATGCATTTGAGAAGACGGTG
TCGTCAACGACACGTTCGGCTCGTCCAGGCGAAGTGCATGGCGTGGATTA
TTTGTTTGTATCTGAAGATGACTTTAAGCAATCTTTAGATAGGGAAGATT
TTTTGGAATGGGTCTTTTTATTTGGGACTTATTACGGAACGAGTAAGGCG
GAGATTTCTAGAGTTCTGCAAAAGGGTAAGCACTGTATAGCCGTGATTGA
TGTACAAGGAGCTTTGGCTCTGAAGAAGCAAATGCCGGCAGTCACTATTT
TTATTCAAGCTCCCTCTCAAGAAGAACTTGAGCGCCGTTTGAATGCTCGG
GATTCAGAGAAAGATTTCCAGAAGAAAGAAAGATTAGAGCATAGCGCTGT
CGAAATTGCTGCCGCTAGCGAATTTGATTATGTTGTGGTTAATGATGATT
TGATTACAGCATATCAAGTTTTAAGAAGTATTTTTATAGCTGAAGAACAT
AGGATGAGTCATGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy