Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR24 IGR21 IGR22 IGR23 IGR19 IGR25 IGR20 CT021 recD, - CT033 CT031 rl31, - CT022 rl19, - CT028 rnhB, - CT029 trmD, - CT027 prfA, - CT023 ffh, - CT025 metG, - CT032 CT021 recD, - CT033 CT031 rl31, - CT022 rl19, - CT028 rnhB, - CT029 trmD, - CT027 prfA, - CT023 ffh, - CT025 metG, - CT032 CT021 recD, - CT033 rl31, - CT022 rl19, - CT028 rnhB, - CT029 trmD, - CT027 prfA, - CT023 ffh, - CT025 metG, - CT032 rs16, - CT026 gmk, - CT030 hemK,yfcB, - CT024 rs16, - CT026 gmk, - CT030 hemK,yfcB, - CT024 CT031
* Calculated from Protein Sequence

Gene ID: CT027

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trmD  

Definition:
tRNA (guanine-N-1)-methyltransferase

Gene Start:
31641

Gene Stop:
32696

Gene Length:
1056

Molecular Weight*:
39734

pI*:
5.62

Net Charge*:
-5.10

EC:
2.1.1.31  

Functional Class:
translation; tRNA modification  

Pathway: pathway table

Secondary Evidence:
Wikstrom PM, Bystrom AS, Bjork GR. 1988. Non-autogenous control of ribosomal protein synthesis from the trmD operon in Escherichia coli. J Mol Biol. 203(1):141-52.

Persson BC, Bylund GO, Berg DE, Wikstrom PM. 1995. Functional analysis of the ffh-trmD region of the Escherichia coli chromosome by using reverse genetics. J Bacteriol 177(19):5554-60.

Bystrom AS, Bjork GR. 1982. Chromosomal location and cloning of the gene (trmD) responsible for the synthesis of tRNA (m1G) methyltransferase in Escherichia coli K-12. Mol Gen Genet 188(3):440-6.

Comment:
This protein is identical to GenBank accession AAC67617 (genome position accession AE001277). This enzyme catalyzes the addition of N(1)-methylguanine to tRNA.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to tRNA-(guanine-N1)-methyltransferase sequences,
e.g. residues 1-219 are 48% similar to TRMD_HAEIN. Residues 1-219 are
44% similar to TP0908, apredicted trmD protein in T.pallidum. CT027 is also
similar to MG445 in M.genitalium.

CT027 is orthologously related to CPn0117: residues 1-348 of
CT027 are 58% similar to residues 1-356 of CPn0117, tRNA
(guanine N-1)-methyltransferase, trmD, from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0336
COG name: tRNA-(guanine-N1)-methyltransferase
Functional Class:  J
The phylogenetic pattern of COG0336 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 21-219 are 50% similar to a t-RNA(guanine-N1) methyltransferase
domain represented by TRMD_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 22 to 228 (E-value = 6.5e-91) place CT027 in the tRNA_m1G_MT family which is described as tRNA (Guanine-1)-methyltransferase (PF01746)

PDB Hit:
none

Gene Protein Sequence:
MEIDILSLFPDYFASPLQATILGRAIKQGALSVRSRDIREFGLGKWKQVD
DSPYNGEGMLLMAEPVVQAIRSIRRKKSKVIYLSPQGQLLSAKKSRELAS
CSHLVLLCGHYEGIDERALTAEVDEEISIGDYVLTNGCAAALVLVDALAR
FIPGVLGNQESAEYDSLENGLLEGPQYTRPRVFEGESVPEVLLCGDHQKI
ADWRKQVSLERTRERRPDLYLQYFYGNSACLSTQEDLPRIEVVSPKTFSV
VLEVQDLRKAKKFYSRMFGKECWDGDKLFLLGKTSLYLQQTKETRGPTTV
FIELETDHDFVRFLKRWEILGGELGEQGTGGFPLRQVFDLDGHIWVVSCV
QK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGATAGATATTCTCTCTTTATTCCCGGACTATTTTGCTAGTCCTTT
ACAGGCGACTATTTTGGGCCGAGCAATTAAACAGGGAGCTTTATCTGTTC
GCTCCCGAGATATTCGAGAGTTCGGCTTAGGGAAATGGAAGCAGGTAGAT
GACTCTCCCTATAATGGAGAGGGGATGCTTTTGATGGCAGAGCCTGTGGT
ACAGGCTATTAGAAGCATAAGAAGAAAGAAGTCCAAGGTCATATACTTAT
CTCCGCAGGGACAACTTCTTTCCGCAAAGAAAAGTCGTGAACTGGCGTCG
TGTTCGCATTTGGTATTGTTATGTGGACACTATGAGGGAATTGATGAAAG
GGCGTTGACTGCCGAAGTGGATGAGGAGATAAGTATTGGTGATTACGTTC
TCACCAATGGGTGCGCGGCGGCTTTAGTTCTCGTAGATGCTCTTGCGCGC
TTCATTCCGGGAGTTTTAGGGAACCAAGAAAGTGCAGAGTACGACTCTCT
TGAAAATGGATTGTTAGAAGGTCCTCAGTACACTCGTCCACGGGTTTTTG
AGGGTGAGTCGGTCCCTGAAGTGTTGCTCTGTGGAGACCATCAGAAGATT
GCAGATTGGAGAAAACAGGTTAGTCTAGAGAGAACTAGAGAACGTCGACC
AGATCTGTATCTGCAGTATTTTTATGGTAACAGTGCTTGTTTAAGTACTC
AAGAGGATCTCCCTAGGATAGAGGTAGTTTCTCCCAAAACCTTTTCTGTA
GTTTTAGAAGTTCAAGATCTTCGAAAAGCTAAGAAGTTCTATTCCAGGAT
GTTTGGAAAAGAGTGTTGGGACGGAGATAAATTATTCCTTTTAGGGAAGA
CGAGTTTGTACCTGCAACAGACAAAAGAAACAAGAGGCCCGACCACAGTA
TTTATAGAGCTGGAGACCGATCATGATTTTGTTCGTTTTTTAAAACGATG
GGAAATACTCGGAGGGGAGCTTGGTGAACAAGGGACGGGAGGGTTTCCTT
TAAGACAGGTTTTTGATTTAGATGGCCATATTTGGGTTGTCTCTTGTGTA
CAGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy