Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR17 IGR15 IGR19 IGR18 IGR14 IGR20 IGR16 CT018 CT021 lepB, - CT020 rl31, - CT022 CT016 CT017 ileS, - CT019 CT018 CT021 lepB, - CT020 rl31, - CT022 CT016 CT017 ileS, - CT019 CT018 CT021 lepB, - CT020 rl31, - CT022 CT016 CT017 ileS, - CT019
* Calculated from Protein Sequence

Gene ID: CT019

DNA Molecule Name:
1  

Genbank ID:
3328409

Gene Name:
ileS  

Definition:
isoleucyl-tRNA synthetase

Gene Start:
21432

Gene Stop:
24539

Gene Length:
3108

Molecular Weight*:
118983

pI*:
5.32

Net Charge*:
-26.73

EC:
6.1.1.5  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Miller KW, Bouvier J, Stragier P, Wu H. 1987. Identification of the genes in the Escherichia coli ileS-lsp operon. Analysis of multiple polycistronic mRNAs made in vivo. J Biol Chem262(15):7391-7. Medline: 3294831.

Miller KW, Wu HC. 1987. Cotranscription of the Escherichia coli isoleucyl-tRNA synthetase (ileS) and prolipoprotein signal peptidase (lsp) genes. Fine-structure mapping of the lsp
internal promoter. J Biol Chem 262(1):389-93. Medline: 2432063.

Comment:
This sequence is identical to GenBank accession AAC67609 (genome position accession AE001277). See CT302 and CT209.

Blast Summary:  PSI-Blast Search
CT019 is orthologously related to CPn0109: residues 2-1026 of CT019 are 69% similar to residues 4-1031 of CPn0109, a predicted
isoleucyl-tRNA synthetase from C. pneumoniae. Residues 13-767 are 21% similar to CPn0094; and residues 13-834 are 21% similar to CPn0153.

Numerous hits in gapped BLAST to isoleucyl-tRNA synthetase
sequences, e.g., residues 4-1036 are 46% similar to a predicted isoleucyl-tRNA synthetase from Borrelia burgdorferi (2688775), residues 5-1000 are 46% similar to a predicted isoleucine-tRNA synthetase from Homo sapiens (U04953), residues 2-1036 are 33% similar to SYI_METTH, among many others. CT019 is similar to TP0452, a predicted ile-tRNA synthetase in T. pallidum. It is also similar to MG345 in M. genitalium. Also see PG1395.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0060
COG name: Isoleucyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0060 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 46-56 and 587-596 have matches to blocks BL00178A,B, which encompass aminoacyl-tRNA synthetase sequences, e.g., SYI_CAEEL and SYM_MYCGE.

ProDom Summary:  Protein Domain Search
Residues 53-180 are 64% similar to an aminoacyl-tRNA synthetase domain seen in SYI_TETTH. Residues 120-382, 286-333, 356-389, 607-628, 675-763, and 856-1023 are related to well-defined tRNA
synthetase domains, e.g., SYIC_YEAST, SYL_METJA, etc.

Paralogs:  Local Blast Search
CT019 is paralogously related to CT302, thought to be a valyl-tRNA
synthetase, and to CT209, thought to be a leucyl-tRNA synthetase:
residues 11-940 are 22% similar to CT302 and 13-348 and 445-711
are 24% and 23% similar, respectively, to CT209.

Pfam Summary:  Pfam Search
Residues 15 to 630 (E-value = 2.8e-257) place CT019 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

PDB Hit:
None.

Gene Protein Sequence:
MDNEDKISISAKEEKILSFWKEQDIFQKTLDNREGCPTFSFYDGPPFATG
LPHYGHLLAGTIKDVVCRYASMDGHYVPRRFGWDCHGVPVEYEVEKSLGL
TEPGAIERFGVANFNEECRKIVFRYADEWKYFVDRIGRWVDFSATWRTMD
LSFMESVWWVFRSLYDQGLVYEGTKVVPFSTKLGTPLSNFEAGQNYKEVD
DPSVVVKFALQDNQGFLLAWTTTPWTLVSNMALAVHPELTYVRIKDKESG
DEYILGQESLPRWFPDRESYEWIGQLSGKSLVGQSYEPLFPYFQDKKELE
AFRILPADFIEESEGTGIVHMAPAFGEADFFACQEHNVPLVCPVDNQGCY
TAEVKDFVGEYIKSADKGIARRLKNENKLFYQGTVRHRYPFCWRTDSPLI
YKAVNSWFVAVEKVKSKMLKANESIHWTPEHIKQGRFGKWLEGARDWAIS
RNRYWGTPIPIWRSDDGELLVIGSIQELEALSGQKIVDLHRHFIDEIEIN
QNGKSFRRIPYVFDCWFDSGAMPYAQNHYPFERAEETEACFPADFIAEGL
DQTRGWFYTLTVIAAALFDQPAFKNVIVNGIILAEDGNKMSKRLNNYPSP
KMIMDAYGADALRLYLLNSVVVKAEDLRFSDKGVESVLKQVLLPLSNALA
FYKTYAELYGFDPKETDNIELAEIDRWILSSLYSLVGKTRESMSQYDLHA
AVNPFVDFIEDLTNWYIRRSRRRFWDAEDSADRRAAFSTLYEVLVVFSKV
IAPFIPFIAEDMYQQLRGETDPESVHLCDFPHVVLEKILPDLERKMQDIR
EIVALGHSLRKEHKLKVRQPLQNVYIVGSKERKEALAQVGSLIGEELNVK
DVHFCSETPEYVTTLIKPNFRTLGKKVGNRLPEIQRALAGLPQEQIQAFM
HKGQMVVSLGEETISLDKEDITVSWASAEGFVARSSASFVAVLDCQLTEP
LIMEGIARELVNKINTMRRNRKLHVSDRIAIRLHAPVIVQEAFALHKEYI
CEETLTTSVSVIDYKEGEEWDINGHAVSFVLERVER

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAACGAAGATAAGATTAGTATTTCCGCCAAAGAGGAAAAGATTCT
ATCTTTTTGGAAAGAGCAAGATATTTTTCAAAAAACTTTAGACAATCGAG
AGGGCTGCCCCACTTTTTCTTTTTATGACGGGCCTCCATTTGCTACAGGC
TTACCGCATTATGGCCACCTGTTAGCAGGTACAATAAAAGATGTTGTATG
TCGTTATGCGTCGATGGATGGGCATTATGTGCCCCGGCGTTTTGGCTGGG
ATTGTCATGGGGTGCCAGTCGAATACGAAGTAGAGAAATCTTTAGGTCTT
ACCGAGCCAGGAGCTATTGAGCGTTTCGGTGTGGCGAATTTTAACGAAGA
ATGTCGCAAGATTGTTTTCCGATACGCGGATGAATGGAAATATTTTGTGG
ATAGGATCGGCCGATGGGTAGATTTTTCTGCAACATGGAGGACTATGGAC
CTATCTTTCATGGAGAGTGTCTGGTGGGTATTCCGCTCTCTCTATGATCA
AGGACTTGTGTATGAGGGGACCAAAGTAGTTCCTTTTTCTACCAAGCTAG
GTACCCCGCTATCCAATTTCGAAGCTGGCCAAAACTATAAGGAAGTAGAC
GACCCTTCTGTCGTTGTAAAATTTGCTTTGCAAGACAATCAAGGCTTTCT
TCTAGCATGGACCACAACTCCTTGGACTCTTGTTTCAAATATGGCGCTAG
CTGTGCATCCTGAGCTCACCTATGTCCGTATTAAAGACAAAGAATCAGGA
GACGAATATATCCTGGGACAGGAAAGTTTGCCTCGTTGGTTCCCAGATCG
AGAATCTTATGAATGGATAGGACAATTGTCTGGAAAGAGTCTTGTTGGAC
AAAGTTACGAACCGCTTTTCCCTTATTTCCAAGATAAAAAGGAGTTAGAG
GCTTTTCGTATTCTTCCTGCAGATTTTATTGAGGAAAGTGAGGGGACGGG
TATTGTTCATATGGCACCAGCTTTTGGAGAAGCTGACTTTTTTGCTTGCC
AGGAACATAACGTACCTCTAGTGTGCCCTGTTGATAATCAGGGGTGTTAT
ACCGCTGAGGTGAAGGATTTTGTCGGCGAATATATTAAGTCTGCTGACAA
AGGCATCGCTCGTCGATTGAAGAACGAAAATAAACTGTTCTATCAAGGTA
CAGTTCGTCACCGCTATCCGTTTTGTTGGAGAACTGACTCTCCTTTAATT
TACAAAGCAGTGAATTCTTGGTTCGTTGCTGTAGAAAAGGTAAAGAGTAA
GATGTTAAAAGCCAATGAATCCATTCATTGGACTCCTGAGCATATCAAAC
AAGGACGCTTTGGTAAGTGGTTAGAGGGAGCTCGTGACTGGGCTATCAGT
AGAAATCGTTATTGGGGGACTCCTATACCTATTTGGCGTAGTGACGATGG
AGAGCTTTTGGTCATAGGATCTATCCAGGAACTGGAGGCATTATCTGGAC
AGAAGATTGTAGATTTGCATCGCCATTTTATTGATGAGATAGAAATTAAC
CAGAACGGGAAATCTTTCCGAAGAATCCCTTATGTTTTCGATTGTTGGTT
TGATTCTGGAGCTATGCCATATGCTCAGAATCATTACCCTTTTGAAAGAG
CAGAAGAAACGGAGGCTTGCTTCCCAGCTGACTTTATTGCTGAAGGACTA
GATCAGACTCGAGGTTGGTTCTATACGTTAACCGTTATTGCTGCAGCTTT
ATTCGATCAGCCCGCTTTTAAAAATGTAATTGTAAATGGGATTATTCTTG
CGGAAGACGGAAATAAAATGTCGAAGCGGTTGAATAATTATCCTAGTCCA
AAAATGATTATGGACGCGTATGGAGCAGATGCTTTGCGGCTGTATTTGTT
GAATAGCGTGGTCGTTAAAGCTGAAGATCTTCGCTTTTCCGATAAAGGGG
TAGAGTCTGTGCTTAAGCAAGTTCTATTGCCGTTGTCTAATGCTTTGGCT
TTCTATAAGACTTATGCGGAATTGTATGGTTTTGATCCTAAAGAAACAGA
CAATATAGAACTTGCTGAAATAGACCGCTGGATTCTTTCTTCTCTATACA
GTTTGGTAGGGAAAACTCGAGAAAGTATGTCGCAATATGATTTACATGCT
GCTGTAAATCCTTTTGTGGATTTCATTGAAGATTTAACTAACTGGTATAT
TCGTAGGTCGCGGCGACGTTTTTGGGATGCCGAGGATTCTGCAGATCGAC
GGGCAGCATTCTCTACACTTTATGAAGTGTTGGTAGTCTTTTCTAAAGTC
ATTGCGCCATTCATTCCTTTTATTGCAGAAGATATGTACCAGCAATTACG
AGGAGAAACGGATCCCGAGTCTGTGCACTTATGTGATTTTCCTCACGTTG
TCCTAGAAAAGATTCTTCCTGATTTGGAAAGGAAAATGCAGGATATTCGA
GAGATTGTAGCTCTAGGGCATTCTTTGCGTAAGGAGCATAAACTGAAAGT
ACGTCAACCTCTTCAAAACGTGTATATTGTAGGAAGCAAGGAGAGAAAGG
AGGCTTTAGCTCAAGTTGGATCCTTGATTGGAGAAGAGCTTAATGTGAAA
GACGTACATTTTTGTTCAGAAACTCCGGAGTATGTAACCACTTTGATTAA
GCCTAATTTCCGAACCTTAGGGAAGAAGGTAGGTAATCGTCTTCCAGAAA
TTCAAAGAGCTCTAGCAGGATTGCCTCAAGAGCAAATTCAGGCTTTTATG
CACAAAGGGCAGATGGTTGTTTCTCTAGGAGAAGAGACCATTTCTTTAGA
TAAAGAGGACATTACAGTTTCTTGGGCATCGGCTGAAGGATTTGTAGCGA
GAAGCTCAGCTTCTTTTGTAGCAGTACTGGATTGTCAGTTAACAGAGCCT
TTAATTATGGAAGGTATAGCCAGAGAGTTGGTTAATAAGATCAACACTAT
GCGAAGAAATAGGAAATTACACGTTTCTGATCGCATTGCTATACGTTTAC
ATGCCCCTGTTATCGTTCAGGAAGCGTTCGCTTTACACAAAGAGTATATT
TGTGAAGAGACATTAACCACTTCCGTTTCTGTGATCGATTATAAAGAAGG
GGAAGAGTGGGATATTAACGGTCACGCAGTGTCCTTCGTTCTGGAGCGAG
TTGAGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy