Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR11 IGR15 IGR12 IGR9 IGR14 IGR13 IGR10 IGR16 CT018 ybbP, - CT012 CT011 phoH, - CT015 htrB, - CT010 CT016 cydB, - CT014 CT017 cydA, - CT013 CT018 ybbP, - CT012 CT011 phoH, - CT015 htrB, - CT010 CT016 cydB, - CT014 CT017 cydA, - CT013 CT018 ybbP, - CT012 CT011 phoH, - CT015 htrB, - CT010 CT016 cydB, - CT014 CT017 cydA, - CT013
* Calculated from Protein Sequence

Gene ID: CT014

DNA Molecule Name:
1  

Genbank ID:
3328403

Gene Name:
cydB  

Definition:
cytochrome oxidase d subunit II

Gene Start:
14964

Gene Stop:
16022

Gene Length:
1059

Molecular Weight*:
39521

pI*:
8.60

Net Charge*:
6.33

EC:
1.10.3.-  

Functional Class:
cofactor biosynthesis; ubiquinone and quinones  
energy metabolism; electron transport  

Pathway: pathway table

Secondary Evidence:
Winstedt L, Yoshida K, Fujita Y, von Wachenfeldt C. 1998. Cytochrome bd biosynthesis in Bacillus subtilis: characterization of the cydABCD operon. J Bacteriol 180(24):6571-80. Medline: 9852001.

Muller MM, Webster RE. 1997. Characterization of the tol-pal and cyd region of Escherichia coli K-12: transcript analysis and
identification of two new proteins encoded by the cyd
operon. J Bacteriol 179(6):2077-80. Medline: 9068659.

Miller, M. J., and Gennis, R. B. 1983. The purification and characterization of the cytochrome d terminal oxidase complex of the Escherichia coli aerobic respiratory chain. J. Biol. Chem. 258, 9159-1965. Medline: 6307994.

Comment:
This sequence is identical to GenBank accession AAC67604 (genome position accession AE001276). It catalyzes the synthesis of ubiquinone-8 from ubiquinol-8. See CT014 for the subunit II (cydB). In E. coli, Fnr represses transcription of cydA under anaerobic conditions (see Cotter, P.A., et al., J. Bacteriol. 172(11): 6333-6338 (1990). Medline: 2172211). Also in E. coli, iron-dependent transcription of cydA is independent of Fur. Under anaerobic and iron-limiting conditions, cydA appeared to be elevated slightly (Cotter, P.A., et al., FEMS Microbiol Lett. 79(1-3):227-32 (1992). Medline: 1478458). Also, it is believed that in E. coli the cytochrome b-558-d complex is synthesized as an alternative oxidase for more efficient utilization of oxygen at low oxygen concentration. By changing the contents of the two terminal oxidases, E. coli cells can maintain efficient oxidative energy conservation over a wide range of oxygen pressures (Kita, K., et al., Methods Enzymol 126:94-113 (1986). Medline: 2856144).

Blast Summary:  PSI-Blast Search
Residues 1-353 are 60% similar to CPn0103.

Hits in gapped BLAST to cytochrome oxidase D subunit II sequences,
e.g. residues 8-350 are 31% similar to the protein from Aquifex aeolicus(AE000736). No similarities to T. pallidum or M. genitalium.

CT013 is similar to PG803 (4e-49).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1294
COG name: Cytochrome bd quinol oxidase and cytochrome oxidase complexes, subunit 2
Functional Class:  C
The phylogenetic pattern of COG1294 is -----q-cEbrh------inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 12-344 are 29% similar to a cytochrome D ubiquinol oxidase subunit II domain represented by CYDB_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 7 to 348 (E-value = 2e-184) place CT014 in the Cyto_ox_2 family which is described as Cytochrome oxidase subunit II (PF02322)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
23
transmembrane  
63  
97
transmembrane  
122  
156
transmembrane  
166  
187
transmembrane  
205  
227
transmembrane  
238  
258
transmembrane  
271  
300
transmembrane  
319  
341

PDB Hit:
None.

Gene Protein Sequence:
MEFSLATILPVVWYVILCIAVFAYSLGDGFDLGLSTIYFLSKDEKERRLL
LNSIGPVWDGNEVWFVIMFAGLFAGFPTAYGTLLSIFYMPIWTMVMLYIF
RGCSLEFRSKAESNRWKLFWDVLFSISGMSISFFLGTLAGNLLVGFPIAP
DTSYSSLSWKLFFRPYPVLCGLFVVTAFALHGISFALMKTTEGLHERLKN
KFSYVLSSYLVLYLSLLIATILGMPQTLGVCCRIEGAPGIPAYPLIILLS
VVTLSCCYAEKRAVSIGKYGKAFVLSCINLLSPILAYNILLFPNLLVSTV
DNRYTMTVFNAAAETRTLQHLVTIVLIGLPFVVAYAVYIYRVFRGKTDFP
SIY

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGTTTTCTTTAGCAACGATTCTTCCTGTTGTTTGGTATGTTATTCT
TTGCATCGCTGTATTTGCTTATTCTTTAGGAGACGGATTTGATTTAGGAT
TGAGCACGATCTATTTTCTTTCTAAAGATGAGAAAGAACGTAGGCTACTC
TTAAACTCAATAGGCCCCGTATGGGATGGCAATGAAGTATGGTTTGTCAT
CATGTTTGCTGGATTGTTTGCAGGGTTCCCGACCGCTTATGGAACCCTGC
TTTCCATCTTTTACATGCCTATTTGGACTATGGTCATGCTATACATATTC
CGAGGCTGTTCTCTAGAGTTTCGTAGTAAAGCAGAGTCTAACCGATGGAA
GCTGTTCTGGGATGTTCTCTTTTCTATCTCAGGGATGTCTATTAGCTTTT
TCCTGGGGACATTAGCTGGGAATTTATTAGTTGGATTTCCGATCGCTCCA
GATACTTCGTATAGTTCTTTATCTTGGAAACTATTTTTCCGCCCTTATCC
AGTATTATGTGGGTTATTTGTAGTTACTGCATTTGCTCTACATGGGATTA
GTTTTGCTTTAATGAAAACTACAGAAGGGCTGCACGAACGTTTGAAAAAT
AAATTTTCTTATGTTCTGTCTAGTTACTTGGTTTTGTATCTTTCCTTGCT
CATTGCGACTATTTTAGGGATGCCTCAGACCCTAGGAGTGTGCTGTCGTA
TTGAAGGCGCTCCTGGTATACCAGCGTATCCACTCATCATCTTATTATCG
GTAGTAACGTTGTCTTGCTGTTATGCAGAAAAGAGAGCGGTCTCTATTGG
TAAATACGGGAAAGCTTTTGTTCTCTCTTGTATCAACTTGTTGTCTCCAA
TACTTGCGTATAACATATTGCTCTTCCCTAATTTATTAGTATCTACGGTG
GATAATCGTTATACTATGACTGTGTTTAACGCAGCCGCGGAAACGCGAAC
CTTACAACACCTAGTCACTATTGTTTTAATTGGGCTCCCGTTTGTCGTTG
CTTACGCGGTATACATATACCGGGTGTTCAGAGGCAAAACAGATTTCCCT
TCGATTTAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy