Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR11 IGR12 IGR9 IGR14 IGR13 IGR8 IGR10 ybbP, - CT012 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT016 cydB, - CT014 CT017 cydA, - CT013 ybbP, - CT012 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT016 cydB, - CT014 CT017 cydA, - CT013 ybbP, - CT012 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT016 cydB, - CT014 CT017 cydA, - CT013
* Calculated from Protein Sequence

Gene ID: CT013

DNA Molecule Name:
1  

Genbank ID:
3328402

Gene Name:
cydA  

Definition:
cytochrome oxidase D subunit I

Gene Start:
13612

Gene Stop:
14949

Gene Length:
1338

Molecular Weight*:
50177

pI*:
9.95

Net Charge*:
14.07

EC:
1.10.3.-  

Functional Class:
cofactor biosynthesis; ubiquinone and quinones  
energy metabolism; electron transport  

Pathway: pathway table

Secondary Evidence:
Winstedt L, Yoshida K, Fujita Y, von Wachenfeldt C. 1998. Cytochrome bd biosynthesis in Bacillus subtilis: characterization of the cydABCD operon. J Bacteriol 180(24):6571-80. Medline: 9852001.

Muller MM, Webster RE. 1997. Characterization of the tol-pal and cyd region of Escherichia coli K-12: transcript analysis and
identification of two new proteins encoded by the cyd
operon. J Bacteriol 179(6):2077-80. Medline: 9068659.

Miller, M. J., and Gennis, R. B. 1983. The purification and characterization of the cytochrome d terminal oxidase complex of the Escherichia coli aerobic respiratory chain. J. Biol. Chem. 258, 9159-1965. Medline: 6307994.

Comment:
This protein is identical to GenBank accession AAC67603 (genome position accession AE001276). It catalyzes the synthesis of ubiquinone-8 from ubiquinol-8. See CT014 for the subunit II (cydB). In E. coli, Fnr represses transcription of cydA under anaerobic conditions (see Cotter, P.A., et al., J. Bacteriol. 172(11): 6333-6338 (1990). Medline: 2172211). Also in E. coli, iron-dependent transcription of cydA is independent of Fur. Under anaerobic and iron-limiting conditions, cydA appeared to be elevated slightly (Cotter, P.A., et al., FEMS Microbiol Lett. 79(1-3):227-32 (1992). Medline: 1478458). Also, it is believed that in E. coli the cytochrome b-558-d complex is synthesized as an alternative oxidase for more efficient utilization of oxygen at low oxygen concentration. By changing the contents of the two terminal oxidases, E. coli cells can maintain efficient oxidative energy conservation over a wide range of oxygen pressures (Kita, K., et al., Methods Enzymol 126:94-113 (1986). Medline: 2856144).

Blast Summary:  PSI-Blast Search
CT013 is orthologously related to CPn0102: residues 1-446 of CT013 are 70% similar to residues 1-447 of CPn0102 (accession
AE001596) a predicted cytochrome oxidase subunit I from C. pneumoniae.

Hits in gapped BLAST to cytochrome D ubiquiol oxidase subunit I (cydA) from Rickettsia prowazekii (accession CAA14679), a cytochrome D ubiquiol oxidase subunit I from B. subtilis (P94364), and a cyanide-insensitive terminal oxidase D subunit I from P. aeruginosa (Y10528), among many others, mostly oxidase subunits. No significant similarities to T. pallidum, U. urealyticum, M. pneumoniae or M. genitalium.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1271
COG name: Cytochrome bd quinol oxidase, subunit 1
Functional Class:  C
The phylogenetic pattern of COG1271 is A----q-cEBrh------inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 253-265 are matched to block BL00599E,
concerned with aminotransferases class-II pyridoxal phosphate
attachment site, e.g.BIOF_ERWHE.
Residues 11-31, 103-423 are matched to block PR00466C,
concerned with Cytochrome B-245 heavy chain signature,e.g.C24B_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 6-406 are 34% similar to a cytochrome D ubiquinol oxidase
subunit I domain represented by CYDA_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 6 to 446 (E-value = 4.3e-132) place CT013 in the Bac_Ubq_Cox family which is described as Bacterial Cytochrome Ubiquinol Oxidase (PF01654)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
11  
41
transmembrane  
49  
77
transmembrane  
92  
118
transmembrane  
128  
149
transmembrane  
169  
203
transmembrane  
223  
239
transmembrane  
319  
346
transmembrane  
403  
428

PDB Hit:
None.

Gene Protein Sequence:
MSAEILARVQFALFIGFHYLFVPISLGLSMMIVLMEGLYLFTKKSIYKQL
TWFWIRIFTLTFVVGVVTGLMQIFSFGANWSRFAEYTGNVFGMFLGSEGM
FAFFLESGFLGVLLFGRYKVSKKMHFFSACMVALGAHMSAFWIVCANSWM
QTPSGYEMVMRNGMLVPQMTSFWAAVLSPSALQRFTHVVLGAWLSGIFLV
LSVSAHYLRKERHKDFANQGLKISMFCAFLVLALQLWSADVTARGVAKHQ
PAKLAAFEGVFKTQGHTPIYLLGIVDMKKERVIGIPIPSGLSLLVHRNAK
TPVTGLDQFPKDEWPNVAFVFQTYHLMVMLWGVMVLLALIAFAVYKKKSW
SCKKGILWILSFSVLCPELCNEIGWISTEVGRQPWVVYGLLKTKDATSPI
VNAGQIWQSLILFSIIFICLLSVFVSLLLKKIGEGPDEQDLIEVDL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGCTGAGATATTGGCGAGAGTACAGTTTGCGTTGTTTATCGGATT
TCATTATCTGTTTGTCCCCATTAGTTTGGGATTAAGTATGATGATTGTTC
TTATGGAGGGGCTCTACTTATTCACAAAAAAAAGTATTTATAAGCAGTTG
ACCTGGTTTTGGATTAGGATTTTCACCTTAACTTTTGTTGTTGGCGTTGT
CACAGGATTGATGCAGATTTTTTCCTTCGGAGCAAATTGGTCTCGATTCG
CAGAATATACTGGAAACGTATTTGGAATGTTCCTTGGTAGCGAGGGAATG
TTTGCTTTCTTCTTAGAATCTGGATTTCTAGGAGTTTTGTTATTTGGTCG
CTATAAAGTATCAAAAAAAATGCACTTTTTTTCAGCCTGTATGGTTGCGC
TCGGCGCTCACATGAGTGCTTTTTGGATTGTTTGTGCGAACTCTTGGATG
CAAACGCCTTCCGGTTATGAAATGGTCATGCGTAATGGTATGTTAGTTCC
CCAAATGACTTCTTTTTGGGCAGCGGTGTTGTCTCCTTCTGCTTTGCAGC
GTTTTACACATGTTGTTCTTGGCGCTTGGTTATCTGGGATATTTCTTGTT
CTTTCCGTTAGTGCTCACTATCTACGTAAAGAGCGGCATAAAGATTTTGC
AAATCAGGGGTTAAAAATCAGCATGTTTTGTGCTTTCCTTGTTTTGGCTT
TGCAGCTTTGGTCAGCAGATGTCACTGCAAGAGGGGTCGCTAAACACCAA
CCTGCCAAGCTTGCTGCGTTTGAAGGTGTTTTTAAGACTCAAGGACACAC
CCCAATTTATTTACTCGGCATTGTAGATATGAAAAAAGAGCGAGTCATTG
GGATCCCCATTCCTTCTGGTTTATCGCTTCTTGTTCACCGAAATGCAAAA
ACTCCTGTTACAGGACTGGATCAGTTCCCTAAAGACGAATGGCCAAATGT
CGCTTTCGTTTTTCAAACGTATCACTTAATGGTCATGTTATGGGGAGTAA
TGGTACTTTTAGCTCTGATAGCCTTTGCTGTGTATAAGAAAAAATCTTGG
AGCTGCAAGAAGGGGATCTTATGGATACTTTCCTTCTCTGTGCTATGTCC
TGAGTTATGTAATGAAATCGGCTGGATTTCTACAGAGGTAGGGCGTCAAC
CTTGGGTTGTTTATGGCTTATTAAAAACTAAAGATGCGACCTCTCCTATC
GTGAACGCAGGGCAAATTTGGCAGTCTTTGATCCTGTTTTCGATTATTTT
TATTTGTTTATTAAGTGTCTTTGTCTCGCTTCTTTTGAAAAAGATAGGTG
AGGGACCAGATGAGCAAGACCTTATAGAAGTAGATTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy