Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR11 IGR7 IGR12 IGR9 IGR13 IGR8 IGR10 ybbP, - CT012 rnhB, - CT008 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT016 CT007 cydB, - CT014 cydA, - CT013 ybbP, - CT012 rnhB, - CT008 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT016 CT007 cydB, - CT014 cydA, - CT013 ybbP, - CT012 rnhB, - CT008 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT016 CT007 cydB, - CT014 cydA, - CT013
* Calculated from Protein Sequence

Gene ID: CT012

DNA Molecule Name:
1  

Genbank ID:
3328401

Gene Name:
ybbP  

Definition:
conserved hypothetical protein (basic)

Gene Start:
13337

Gene Stop:
12546

Gene Length:
792

Molecular Weight*:
29958

pI*:
10.51

Net Charge*:
9.59

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAC67602 (genome position accession AE001276).

Blast Summary:  PSI-Blast Search
CT012 is orthologously related to CPn0101: residues 5-264 of CT012 are 73% similar to residues 5-264 of CPn0101, a conserved hypothetical protein (basic) from C. pneumoniae.

Hits in gapped BLAST to YbbP protein, residues 8-264 are 31% similar to AB002150, from B. subtilis. Residues 8-252 are 33% similar to TP0826, a hypothetical in T. pallidum. CT012 is also similar to MG105, a hypothetical in M. genitalium and to PG1388.



COGS Summary:  COGS Search
BeTs to 9 clades of COG1624
COG name: Uncharacterized ACR
Functional Class:  S
The phylogenetic pattern of COG1624 is am-k-q-c-B----gpolin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 104-240 are 37% similar to a hypothetical protein MG105
domain represented by Y105_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 108 to 231 (E-value = 6.4e-66) place CT012 in the DUF147 family which is described as Domain of unknown function DUF147 (PF02457)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
14  
36
transmembrane  
40  
56
transmembrane  
61  
85

PDB Hit:
None.

Gene Protein Sequence:
MFVGITYYTTPLLEIALIWVVLNYLLKFFWGTGAMDLVFGLLSFLCLFVL
AEKLHLPVIRNLMLHVVNIAAIVVFIIFQPEIRLALSRIRLRRGKFVINM
QDEFIDHLTACIYRMAERQIGALIVLENERLLNDLLNLSAVKINADFSEE
LLEAIFEPSSHLHDGAVLMRGETISYARVILPLAHDTTQLSRSMGTRHRA
ALGASQRTDALVIVVSEKTGAVSLARDGILTRGVKMDRFKAILRSILTRN
ERKTNPIISWMRKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCGTAGGTATAACGTATTACACCACACCTCTGTTGGAGATAGCTTT
AATTTGGGTGGTCCTTAATTATTTGCTAAAGTTTTTCTGGGGAACAGGCG
CCATGGACCTCGTCTTTGGCTTGTTGTCTTTTCTTTGCCTATTTGTTCTA
GCAGAAAAACTTCATCTCCCCGTTATTCGCAATTTGATGCTTCATGTAGT
GAATATTGCGGCTATCGTGGTATTTATTATCTTCCAACCAGAAATTCGCC
TTGCTCTCTCTAGGATACGCTTGCGTAGAGGGAAATTTGTCATCAATATG
CAAGACGAATTCATTGACCATTTGACAGCATGCATCTATCGCATGGCTGA
ACGACAAATCGGAGCTCTCATTGTATTAGAAAATGAGCGTCTTTTGAATG
ATCTGCTTAATCTCTCTGCCGTGAAAATTAATGCAGATTTTTCAGAAGAA
CTTCTCGAAGCTATTTTTGAGCCCTCCTCCCATCTACATGATGGAGCCGT
GTTAATGAGAGGCGAGACTATCTCTTACGCTAGAGTAATTCTTCCTCTTG
CTCATGATACCACACAACTGTCGCGATCCATGGGAACGCGTCATCGTGCA
GCACTCGGTGCTAGTCAGCGTACCGATGCTCTCGTGATTGTAGTATCAGA
AAAGACCGGTGCAGTTTCCTTAGCTCGTGATGGAATTTTAACTCGTGGAG
TAAAGATGGATAGATTTAAAGCCATCCTGCGAAGTATCCTAACGCGCAAT
GAACGAAAAACAAACCCTATTATCTCCTGGATGCGTAAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy