Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR11 IGR7 IGR12 IGR9 IGR8 IGR10 IGR6 CT006 ybbP, - CT012 rnhB, - CT008 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT007 cydB, - CT014 cydA, - CT013 CT006 ybbP, - CT012 rnhB, - CT008 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT007 cydB, - CT014 cydA, - CT013 CT006 ybbP, - CT012 rnhB, - CT008 CT011 phoH, - CT015 htrB, - CT010 yfgA, - CT009 CT007 cydB, - CT014 cydA, - CT013
* Calculated from Protein Sequence

Gene ID: CT011

DNA Molecule Name:
1  

Genbank ID:
3328400

Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
12546

Gene Stop:
11293

Gene Length:
1254

Molecular Weight*:
48056

pI*:
7.31

Net Charge*:
1.10

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAC67601 (genome position accession AE001276). See CPn0100.

Blast Summary:  PSI-Blast Search
Residues 1-415 are 62% similar to residues 1-415 of CPn0100, a predicted Chlamydia-specific hypothetical protein from C. pneumoniae. No similarities to T. pallidum or M. genitalium.


COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 24-49 are weakly matched (94th percentile) to block BL01195A, concerned with peptidyl-tRNA hydrolase, e.g. PTH_MYCTU.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
27
non-globular  
234  
301

PDB Hit:
None.

Gene Protein Sequence:
MINFVSWISRNWLQKLVSLGFAIIIWALANQSITVTRTFHNIPVRVIDLA
PEQTVIGLQANGLLKKKVAMMITGNKSVVEKLRPSNLEIVISAKGRTESW
IETIDPYNLVCLDTDIHLRKNIKSVTSEDIFIRLTQFVTEDVSVTITKPI
GRAPKGYEYLDTWPKYLVQKVSGPKEYVSSLKDHGLELTFNLNKVSFEEL
DRNRLAQGNLDEVVYLVPEDWKKVYIPFDNSYMELNDPQADFLRLLFLKQ
EFIPLNINLPVLLFFPVENSQLVNPQNCYLEENAPLVLNHGIYQMDLPLY
VKDVSHLFLDVVKNNIALTIIMEPPVKSQREHFIHWAVEFLDEKTLENTF
VQAVMAQEQKTNKHMILDEAGIRHRFREYLRKLTLFDQNGEPLALTARTS
GNKVIIQVTSSSLKKKSS

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCAATTTCGTCTCTTGGATTTCTCGTAATTGGCTCCAAAAACTCGT
TTCTTTAGGTTTTGCCATTATTATCTGGGCGCTTGCAAATCAGTCCATTA
CGGTAACGAGAACTTTTCATAATATTCCTGTACGCGTTATTGATCTAGCT
CCGGAACAGACTGTAATCGGATTGCAGGCAAATGGTCTGCTAAAGAAAAA
AGTTGCCATGATGATTACAGGAAATAAATCTGTTGTTGAGAAGCTTCGCC
CTTCCAATCTAGAGATAGTGATCAGTGCCAAAGGACGAACTGAAAGTTGG
ATAGAAACCATCGATCCTTACAACTTAGTATGCTTGGACACAGACATCCA
TTTACGTAAAAATATTAAAAGCGTCACATCGGAAGACATTTTCATTCGTC
TAACCCAATTTGTTACCGAAGATGTTTCTGTCACTATCACTAAACCCATA
GGCAGAGCTCCTAAAGGATATGAATACCTAGACACCTGGCCTAAGTATTT
AGTACAAAAGGTAAGTGGTCCTAAAGAATACGTTTCTTCTTTAAAAGATC
ATGGTTTGGAATTAACTTTTAACCTTAATAAAGTTTCTTTTGAAGAACTG
GACCGCAATCGTCTAGCTCAAGGGAATCTTGATGAAGTAGTATACCTTGT
CCCTGAAGACTGGAAAAAAGTTTATATACCTTTCGACAATAGCTACATGG
AATTGAATGATCCGCAAGCAGATTTTTTGCGACTTCTTTTCTTAAAACAA
GAATTTATTCCTCTTAATATTAATCTTCCGGTCCTTCTATTTTTCCCTGT
AGAAAATAGTCAACTTGTGAACCCACAAAACTGCTATCTTGAAGAGAATG
CTCCTCTAGTACTCAATCATGGGATCTACCAAATGGACCTACCGCTTTAT
GTAAAAGATGTCAGCCATCTGTTCCTAGATGTTGTAAAAAATAATATAGC
GCTCACTATTATTATGGAGCCTCCTGTAAAATCTCAGCGAGAACACTTCA
TTCATTGGGCTGTAGAATTTCTAGACGAGAAAACTTTAGAGAATACTTTT
GTTCAGGCAGTTATGGCTCAAGAACAAAAGACGAATAAACATATGATCCT
TGACGAAGCAGGTATTCGACATCGCTTTAGAGAATACTTACGAAAACTTA
CTCTATTTGATCAAAATGGCGAACCTTTAGCCTTAACGGCGCGTACGTCA
GGAAATAAAGTGATTATTCAAGTAACGTCATCCTCTCTAAAGAAAAAATC
TTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy