Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR11 IGR7 IGR5 IGR9 IGR8 IGR10 IGR6 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 cydB, - CT014 cydA, - CT013 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 cydB, - CT014 cydA, - CT013 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 cydB, - CT014 cydA, - CT013
* Calculated from Protein Sequence

Gene ID: CT010

DNA Molecule Name:
1  

Genbank ID:
3328398

Gene Name:
htrB  

Definition:
lipid A biosynthesis, lauroyl acyltransferase (htrB)

Gene Start:
11158

Gene Stop:
9794

Gene Length:
1365

Molecular Weight*:
52047

pI*:
10.88

Net Charge*:
30.57

EC:
2.3.1.-  

Functional Class:
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Secondary Evidence:
Jones BD, Nichols WA, Gibson BW, Sunshine MG, Apicella MA. 1997. Study of the role of the htrB gene in Salmonella typhimurium virulence. Infect. Immun. 65(11):4778-83. Medline: 9353064.

Karow M, Georgopoulos C. 1991. Sequencing, mutational analysis, and transcriptional regulation of the Escherichia coli htrB gene. Mol. Microbiol. 5(9):2285-92. Medline: 1840644.

Comment:
This protein is identical to GenBank accession AAC67600 (genome position accession AE001275).

HtrB is expressed at all temperatures, but accumulation of HtrB transcripts slightly decline with rising temperature, thus its expression is not induced by heat shock.

Blast Summary:  PSI-Blast Search
CT010 is orthologous to CPn0098: residues 11-440 are 50% similar to CP0098.

CT010 shows low similarity to a lipid A biosynthesis lauroyl aceyltransferase (htrB) from Rickettsia prowazekii (accession CAA15149) and very low similarity to a heat shock protein B from HTRB_ECOLI (P24187) and to a hypothetical protein from M. tuberculosis (CAB08631). No similarities to T. pallidum or M. genitalium.



COGS Summary:  COGS Search
BeTs to 4 clades of COG1560
COG name: Lauroyl/myristoyl acyltransferase involved in lipid A biosynthesis
Functional Class:  N
The phylogenetic pattern of COG1560 is --------E-rHuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 43-306 are 26% similar to a heat shock Protein B,
represented by HTRB_ECOLI.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 7 to 316 (E-value = 5.8e-156) place CT010 in the Lip_A_acyltrans family which is described as Bacterial lipid A biosynthesis acyltransferase (PF03279)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
66
transmembrane  
352  
376

PDB Hit:
None.

Gene Protein Sequence:
MLFKRLRTGGKILVDHLVYGLGLGVLTILRLLPRSSLRLFSKGLGTALFY
FISDVRKTALTNLALAFPEKSFAERYQIARQSVQQMIITFVELATVDKFA
KHIDEMIAIATSEDAPEGFFPEEVSSQQELDHFFSRLDRQEGAILFCGHQ
ANWELPFLYITKRYPGLAFAKPVKNRRLNQKIISLRESFQGKIVPPQNAI
NQALRALHRGEVVGIVGDQVLLSSEYSYPLFGSQAFTTTSPALLAYKTKK
TVIAVAIYRKPNGNYLVVPSKAFHANTELSIRESTEQLMDRLMRFLEKGI
TCKPEQWLWLHKRWKRKLRHKFKRRYAFSHILIIVKGTSLQALQRFLIEF
GEFYADASLSLAIIGAADTVLANSFAPYSLQFFSSEEELLAAPNFFPAIV
DLFGLSRKTRLHYKRTGSRKIFTRNELKDSLLQKQSLIQSFHKLLRRVDT
RSRKG

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCTTTAAAAGATTACGTACGGGGGGAAAAATTCTCGTCGATCATCT
CGTTTATGGTTTAGGTCTTGGAGTCCTGACCATCTTACGATTACTTCCTC
GATCCTCCTTACGACTTTTTAGCAAAGGGCTCGGAACCGCTCTCTTCTAT
TTCATCTCTGATGTCCGAAAAACAGCTCTTACTAATTTAGCTTTAGCTTT
CCCTGAAAAAAGTTTCGCCGAACGCTATCAAATTGCACGCCAATCCGTAC
AACAGATGATCATTACGTTTGTAGAGCTTGCAACTGTAGATAAATTCGCC
AAACATATCGATGAAATGATTGCTATTGCTACTTCTGAAGATGCTCCTGA
AGGTTTCTTTCCAGAAGAAGTTTCCTCACAACAAGAACTTGACCATTTCT
TTTCACGTTTAGATCGACAAGAAGGAGCCATTTTATTCTGTGGTCACCAA
GCTAACTGGGAGCTCCCTTTCCTTTACATTACTAAACGCTATCCGGGGCT
GGCTTTTGCCAAACCTGTAAAGAATCGTCGGCTCAATCAAAAAATCATTT
CACTGCGAGAATCTTTCCAAGGCAAAATTGTTCCTCCACAGAATGCAATT
AACCAAGCGCTACGAGCTCTCCACAGAGGAGAGGTAGTCGGCATTGTTGG
GGATCAAGTATTACTTTCTTCGGAATATTCTTATCCTCTTTTCGGCTCCC
AAGCTTTTACTACCACCTCTCCTGCTTTGCTTGCCTACAAAACAAAAAAA
ACAGTTATTGCTGTTGCTATTTACCGAAAACCTAATGGGAACTATCTGGT
CGTCCCTAGTAAAGCATTCCATGCAAATACAGAGCTATCCATACGGGAAT
CTACAGAACAGTTGATGGATCGGCTCATGCGATTTCTTGAAAAAGGGATT
ACATGCAAACCTGAACAGTGGTTGTGGCTTCATAAACGATGGAAAAGAAA
GCTGCGACATAAATTCAAACGACGTTACGCCTTTAGTCACATTCTCATCA
TTGTAAAGGGAACTTCACTACAAGCGCTTCAAAGATTCTTAATAGAGTTT
GGAGAGTTTTATGCAGACGCCTCTCTTTCCTTAGCAATTATAGGAGCTGC
CGATACAGTTCTTGCAAATAGCTTTGCTCCCTACTCTTTGCAATTTTTCT
CTTCAGAAGAAGAGCTGTTAGCTGCTCCAAACTTTTTCCCGGCCATTGTG
GACTTATTCGGATTGTCTAGAAAGACTCGCCTGCATTACAAAAGAACCGG
ATCGAGGAAAATCTTTACGCGTAACGAACTAAAAGATTCTCTCCTACAGA
AACAATCGTTAATACAAAGTTTTCATAAGTTACTACGAAGAGTGGATACC
CGTTCTAGAAAAGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy