Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR7 IGR4 IGR5 IGR9 IGR8 IGR10 IGR6 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 cydA, - CT013 gatB, - CT004 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 cydA, - CT013 gatB, - CT004 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 cydA, - CT013 gatB, - CT004
* Calculated from Protein Sequence

Gene ID: CT008

DNA Molecule Name:
1  

Genbank ID:
3328396

Gene Name:
rnhB  

Definition:
ribonuclease HII

Gene Start:
9119

Gene Stop:
8220

Gene Length:
900

Molecular Weight*:
33005

pI*:
8.76

Net Charge*:
7.35

EC:
3.1.26.-  

Functional Class:
transcription; RNA degradation  

Pathway: pathway table

Secondary Evidence:
Bellgard MI, Gojobori T. 1999. Identification of a ribonuclease H gene in both Mycoplasma genitalium and Mycoplasma pneumoniae by a new method for exhaustive identification of ORFs in the complete genome sequences. FEBS Letters 445: 6-8. Medline: 10069363.

Comment:
This protein is identical to GenBank accession AAC67598 (genome position accession AE001275). Similar to RNase H of retroviruses: degrades ribonucleotide portion of RNA-DNA hybrid. See CT029.

Ribonuclease HII degrades the ribonucleotide moiety on RNA-DNA
hybrid molecules. Endonucleolytic cleavage to 5'-phospho-monoester. Ribonuclease HII is similar with other RNase H from bacteria, fungi, and with RNase H domains from Pol of retroviruses.

Blast Summary:  PSI-Blast Search
CT008 is orthologously related to CPn1068: residues 1-294 of CT008
are 62% similar to residues 1-294 of CPn1068, ribonuclease HII from C. pneumoniae.

Hits in gapped BLAST to ribonuclease HII and to hypothetical protein sequences, e.g. residues 32-289 are 27% similar to U93576,
[Streptococcus pneumoniae]. Residues 151-295 are 28% similar to MG199, a hypothetical in M. genitalium. No similarity to T. pallidum.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1039
COG name: Ribonuclease HII Family 2
Functional Class:  L
The phylogenetic pattern of COG1039 is -----q---b----gp--in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
This protein is identified by Prodom as contributing to
domain O84011_CHLTR. Residues 229-289 are 40% similar to a protein from domain Y199_MYCPN (an MG109 homolog).

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 89 to 291 (E-value = 6.2e-09) place CT008 in the RNase_HII family which is described as Ribonuclease HII (PF01351)

PDB Hit:
None.

Gene Protein Sequence:
MPSSFVSQLSPSLFSILREQLEKKGFTISIPPHTVFQGRSPTVSCTVYQS
GKIVVQGKGTQEFVEFFLEPEILQTFSSQNVQQDLRSRIGVDESGKGDFF
GPLCTAGVYASSPQAIEALYKTSICDSKLIPDAKILSLAQNIRSLCACKV
ITLFPEKYNALYANFQNLNSLLAWTHATIIDNLAPHPAGAVFAISDQFAS
SERVLLQAVRKKCSDIELIQRHRAEQDVVVAAASILAREAFLSSIHALES
QYQIRLLKGASGKVKQRAKEILHNKGQVVLEKVCKTHFKTFNEVLGSGNQ


Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCTCCTCTTTCGTTTCGCAACTGTCTCCTTCTTTATTTTCTATACT
TCGAGAACAACTAGAAAAGAAAGGGTTCACCATCTCTATCCCCCCCCACA
CTGTATTTCAAGGAAGATCTCCGACCGTTAGCTGCACTGTATATCAATCT
GGGAAAATTGTAGTACAGGGTAAAGGAACTCAAGAATTTGTAGAATTTTT
CCTTGAGCCAGAGATTCTACAAACGTTCTCCTCACAGAACGTACAACAGG
ATTTACGTTCTCGCATTGGTGTGGATGAATCTGGAAAAGGAGATTTTTTT
GGGCCTCTGTGCACTGCTGGAGTATATGCTTCTTCCCCACAAGCTATAGA
AGCTCTTTATAAAACCAGCATTTGTGATTCTAAGCTCATTCCTGATGCTA
AAATCCTTTCTTTAGCCCAAAACATTCGCTCGCTTTGTGCGTGTAAAGTC
ATTACCTTGTTCCCAGAAAAATATAACGCACTATATGCCAATTTCCAGAA
TTTAAACTCCCTCCTAGCTTGGACACACGCCACTATTATCGATAATTTGG
CTCCTCATCCTGCAGGAGCAGTCTTTGCTATTTCAGACCAATTCGCCTCT
TCAGAGAGAGTCCTTCTACAGGCTGTTCGCAAGAAGTGCTCGGATATTGA
ATTAATCCAGCGTCATCGTGCAGAACAAGACGTGGTGGTAGCTGCAGCTT
CTATCTTAGCTCGTGAAGCTTTTCTCTCTTCCATACACGCCCTAGAATCT
CAATACCAAATCCGCCTTCTAAAAGGAGCTTCTGGGAAAGTCAAGCAACG
AGCCAAAGAGATTCTTCATAACAAAGGACAGGTTGTATTAGAAAAAGTCT
GTAAAACACATTTCAAAACATTCAATGAGGTGCTTGGTTCGGGCAATCAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy