Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR3 IGR7 IGR4 IGR5 IGR9 IGR8 IGR6 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 gatB, - CT004 gluA,gatA, - CT003 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 gatB, - CT004 gluA,gatA, - CT003 CT006 ybbP, - CT012 rnhB, - CT008 CT005 CT011 htrB, - CT010 yfgA, - CT009 CT007 gatB, - CT004 gluA,gatA, - CT003
* Calculated from Protein Sequence

Gene ID: CT007

DNA Molecule Name:
1  

Genbank ID:
3328395

Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
7251

Gene Stop:
8198

Gene Length:
948

Molecular Weight*:
35624

pI*:
6.26

Net Charge*:
-2.74

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This sequence is identical to GenBank accession AAC67597 (genome position accession AE001275).

Blast Summary:  PSI-Blast Search
CT007 is orthologously related to CPn0441, a predicted Chlamydia-specific hypothetical protein and they share 58% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
None.

Gene Protein Sequence:
MLKVLFHTMTLFGHLLSTPIYIVGDACGKDRDEYKNPPLRAFSFESQFLQ
IENAKFKTLPDQSLRYRQADTSLFATIPVTEMSGFLLSSRYLGAEVSWKS
SKELQDTDLQAVGYFAFQDKSFYQYITLSVGAYTLALTNWQWSVLFSGMV
DPENIEIGSGLYQVVLSSKYHASESLSVIMGVINEVGLHDKQAWPLLGFS
YKPEDRLTLNCIYPVNFSAEYQCTPVCDLGVAYRLTRLRKKFPKNSLATS
EGIFEYSGREIEGNIKLIFWPGQSLKMFGGYSVGNDISLANAHNEDEKIY
KFGSSLFFGASANLHF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAAGGTTCTTTTCCACACGATGACGCTTTTCGGGCATTTGTTATC
GACGCCTATTTATATCGTCGGAGATGCTTGTGGGAAAGATCGGGATGAGT
ACAAGAATCCTCCTCTGAGAGCTTTTTCTTTTGAGAGCCAGTTTTTGCAA
ATAGAGAACGCAAAATTCAAAACTCTCCCAGATCAATCCTTGAGATATCG
ACAGGCGGATACCTCGTTGTTTGCTACGATTCCCGTTACCGAGATGTCGG
GATTTCTTTTATCGTCTCGTTATTTAGGAGCTGAAGTCTCTTGGAAAAGC
TCTAAAGAGCTGCAAGATACAGATCTGCAAGCTGTAGGATATTTCGCTTT
CCAAGACAAATCTTTTTATCAGTATATCACATTGTCTGTAGGAGCCTACA
CACTAGCTCTTACGAATTGGCAGTGGTCTGTACTTTTTTCTGGTATGGTA
GACCCTGAAAATATTGAGATTGGCTCAGGACTCTATCAGGTAGTTTTATC
TTCAAAATATCATGCTTCGGAATCGTTATCTGTGATTATGGGAGTCATTA
ATGAGGTAGGGCTACATGATAAGCAAGCCTGGCCTTTATTAGGGTTCTCT
TATAAACCTGAAGATAGACTCACACTCAATTGTATCTACCCGGTAAATTT
TTCTGCAGAATACCAGTGCACACCTGTTTGCGATTTAGGAGTAGCATATC
GCCTGACACGACTTCGTAAAAAATTCCCTAAAAATTCTTTGGCTACCTCT
GAAGGAATTTTTGAGTATTCAGGAAGAGAAATAGAAGGGAATATCAAGCT
GATTTTTTGGCCAGGACAAAGCCTCAAAATGTTTGGAGGCTATTCCGTAG
GGAATGATATTTCATTGGCAAATGCTCATAACGAAGACGAAAAGATCTAC
AAATTCGGTTCTTCGCTGTTCTTTGGAGCTTCTGCAAATTTGCATTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy