Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR3 IGR2 IGR7 IGR4 IGR5 IGR1 IGR1.1 IGR8 IGR6 CT001 CT006 rnhB, - CT008 CT005 htrB, - CT010 gatC, - CT002 yfgA, - CT009 CT007 gatB, - CT004 gluA,gatA, - CT003 CT875 CT001 CT006 rnhB, - CT008 CT005 htrB, - CT010 gatC, - CT002 yfgA, - CT009 CT007 gatB, - CT004 gluA,gatA, - CT003 CT875 CT001 CT006 rnhB, - CT008 CT005 htrB, - CT010 gatC, - CT002 yfgA, - CT009 CT007 gatB, - CT004 gluA,gatA, - CT003 CT875
* Calculated from Protein Sequence

Gene ID: CT005

DNA Molecule Name:
1  

Genbank ID:
3328393

Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
6241

Gene Stop:
5153

Gene Length:
1089

Molecular Weight*:
39537

pI*:
10.01

Net Charge*:
7.65

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAC67595 (genome position accession AE001275).

Blast Summary:  PSI-Blast Search
CT005 is weakly similar to CPn0443, a hypothetical protein: residues 3-359 are 29% similar to CPn0443.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 4-13 and 7-16 are matched to block PR00021E, concerned with small proline-rich sequences, e.g. SP22_HUMAN.
Residues 37-49 are weakly matched to block PR00788A, concerned with nitrophorin signatures, e.g. A56385.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
CT005 is weakly paralogous to CT414, thought to be an outer membrane protein sequence: residues 235-360 are 26% similar to CT414. Residues 223-303 are 24% similar to CT414. Residues 175-363 are 24% similar to a stretch of CT861, a hypothetical.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
37  
56
transmembrane  
60  
79
transmembrane  
100  
120
transmembrane  
124  
143
non-globular  
216  
363

PDB Hit:
None.

Gene Protein Sequence:
MTPVTPVPPQSPQQVKGLLSRFLTAPDRHPKLRYVYDIALIAISILCIVS
IILWTQGSGLALFAIAPALAIGALGVTLLVSDLAESQKSKEIADTVAAVS
LPFILTGTAAGLMFSAIAVGGGAVILANPLFLMGSMTLGFALMSLHRVTY
QYLSNREQWKQQKKLEQVELAAWESHLPKESKSSALEEVRYSPRLMKRGK
TWRKRAIRRKNYTPIPLVDKTLQTMQPDALFSSTTTHSTDSEQILTSVSP
QSSDTESSSSSSFHTPPNSDKELSDSNSSDSSSSSEYMDALETVAAGDVS
GITPPSKPSSSPKTTRRVVKLSRSERNAQHHRNKDQEQRQDSSESSEEDS
SSDSSQKKKPSRK

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCCAGTAACACCAGTCCCTCCCCAATCTCCCCAACAGGTAAAAGG
GCTTTTATCCAGGTTTCTGACGGCACCCGATCGTCACCCCAAACTACGCT
ATGTTTACGATATTGCTCTTATAGCTATTAGTATTCTCTGTATTGTGAGT
ATCATTCTCTGGACACAAGGGTCTGGACTCGCTTTATTTGCAATCGCTCC
AGCCTTAGCTATTGGAGCCCTAGGAGTCACTCTGCTAGTCTCAGATCTTG
CCGAATCCCAGAAAAGTAAAGAGATTGCTGATACCGTTGCGGCAGTCTCT
CTTCCTTTTATCCTAACAGGGACAGCTGCTGGATTGATGTTTTCTGCTAT
TGCCGTAGGCGGAGGCGCTGTAATCTTAGCGAATCCTCTATTCCTAATGG
GCTCTATGACTCTCGGCTTTGCTCTGATGTCTCTGCATAGAGTGACCTAT
CAATATCTCAGCAATCGCGAGCAATGGAAACAGCAGAAGAAGCTCGAACA
AGTTGAGTTAGCTGCCTGGGAGAGCCATCTTCCTAAAGAAAGCAAATCCT
CCGCTCTGGAAGAGGTTCGCTATTCCCCTCGTTTGATGAAAAGAGGGAAG
ACTTGGCGAAAACGGGCAATCAGAAGAAAAAACTATACACCTATTCCGTT
GGTCGACAAAACATTGCAAACCATGCAACCGGATGCACTCTTCTCCTCTA
CAACCACACATTCTACAGATAGTGAGCAGATTCTAACTTCTGTCAGTCCT
CAAAGCTCAGATACCGAATCCTCCTCTTCTTCTAGCTTCCACACTCCACC
AAATAGCGATAAAGAACTGTCCGACTCGAATTCTTCTGACAGCAGCTCTT
CTTCTGAATATATGGATGCTCTTGAAACCGTAGCTGCAGGAGATGTCTCA
GGAATAACCCCTCCATCCAAACCCTCTTCTTCTCCGAAAACGACACGCCG
CGTCGTAAAGCTCTCTCGCAGCGAGAGAAATGCTCAGCATCATCGTAATA
AAGACCAAGAGCAAAGACAAGACAGCAGCGAATCTTCGGAAGAGGATTCC
TCATCCGATTCATCTCAAAAGAAGAAACCCTCTCGTAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy