Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR3 IGR2 IGR7 IGR4 IGR5 IGR1 IGR1.1 IGR8 IGR732 IGR6 CT001 CT006 rnhB, - CT008 CT005 gatC, - CT002 CT007 gatB, - CT004 gluA,gatA, - CT003 CT875 CT001 CT006 rnhB, - CT008 CT005 gatC, - CT002 CT007 gatB, - CT004 gluA,gatA, - CT003 CT875 CT001 CT006 rnhB, - CT008 CT005 gatC, - CT002 CT007 gatB, - CT004 gluA,gatA, - CT003 CT875
* Calculated from Protein Sequence

Gene ID: CT004

DNA Molecule Name:
1  

Genbank ID:
3328392

Gene Name:
gatB  

Definition:
Glu-tRNA Gln amidotransferase subunit B

Gene Start:
3585

Gene Stop:
5048

Gene Length:
1464

Molecular Weight*:
55008

pI*:
6.18

Net Charge*:
-5.63

EC:
6.3.5.-  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Jahn D, Kim YC, Ishino Y, Chen MW, Soll D. 1990. Purification and
functional characterization of the Glu-tRNA(Gln) amidotransferase
from Chlamydomonas reinhardtii. J Biol Chem 265(14):8059-64.
Medline: 1970821.

Comment:
This protein is identical to GenBank accession AAC67594 (genome position accession AE001275). See CT002 and CT003 for subunits C and A. Disruption of this operon is lethal. This demonstrates that transamidation is the only pathway to Gln-tRNA in B. subtilis and that glutamyl-tRNA amidotransferase is a novel and essential
component of the translational apparatus.

Glu-tRNA Gln amidotransferase B subunit is required to maintain Rho+ mitochondrial DNA. Plays some unknown role in the expression of mitochondrial genes generally, probably at the level of translation.

Blast Summary:  PSI-Blast Search
CT004 is orthologously related to CPn0004: residues 1-482 of CT004
are 75% similar to residues 1-482 of CPn0004, a predicted Glu-tRNA Gln amidotransferase subunit B from C. pneumoniae.

Hits in gapped BLAST to Glu-tRNA Gln amidotransferase subunit B sequences, residues 7-488 are 35% similar to the amidotransferase from B. burgdorferi (AE001140). Residues 8-488 are 35% similar to TP1021, a predicted gatB sequence in T.pallidum. CT004 is similar to MG100, a predicted PET112 protein in M.genitalium.



COGS Summary:  COGS Search
BeTs to 16 clades of COG0064
COG name: Glu-tRNAGln amidotransferase B subunit (PET112 homolog)
Functional Class:  J
The phylogenetic pattern of COG0064 is AMTkyqvc-br-ujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 81-98, 121-133, 182-194, 313-325, 144-175, 192-202, 213-244, 300-331, are matched to blocks BL01234A,B,C,D,E, concerned with PET112 family proteins, e.g. Y100_MYCPN.

ProDom Summary:  Protein Domain Search
Residues 13-286 are 48% similar to a PET112-like protein domain represented by YZDD_BACSU. Residues 301-481 support this assignment.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 6 to 243 (E-value = 1.2e-138) place CT004 in the GatB_N family which is described as PET112 family, N terminal region (PF02934)
Residues 266 to 334 (E-value = 1.1e-34) place CT004 in the GatB family which is described as PET112 family, C terminal region (PF01162)
Residues 336 to 485 (E-value = 1.2e-64) place CT004 in the GatB_Yqey family which is described as GatB/Yqey domain (PF02637)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
207  
239

PDB Hit:
None.

Gene Protein Sequence:
MGIAHTEWESVIGLEVHVELNTESKLFSPARNHFGDEPNTNISPVCTGMP
GSLPVLNKDAVRKAVLFGCAVEGDVALFSRFDRKSYFYPDSPRNFQITQY
EHPIVRGGCIRAVVEGEEKTFELAQTHLEDDAGMLKHFGDFAGVDYNRAG
VPLIEIVSKPCMFSAEDAVAYANALVSILGYIGISDCNMEEGSIRFDVNI
SVRPRGSRELRNKVEIKNMNSFTFMAQALEAEKRRQIEEYLSYPNEDPKK
VVPAATYRWDPEKKKTVLMRLKERAEDYMYFVEPDLPVLQITETYIDEVR
QTLPELPHSKYMRYITDFDIAEDLAMILVGDRHTAHFFETATMSCKNYRA
LSNWITVEFAGRCKARGKTLPFTGILPEWVAQLVNFIDRGVITGKIAKEI
ADRMVSSFGESPEDILRRHPSLLPMTDDHALRAIVKEVVAQNTASVADYK
NGKAKALGFLVGQIMKRTEGKAPPKRVNELLLAAMRDM

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCATAGCACATACTGAATGGGAGTCTGTGATCGGTCTGGAAGTTCA
CGTTGAATTGAATACCGAATCCAAATTATTTAGTCCCGCACGTAATCATT
TTGGTGATGAACCCAACACGAACATTTCTCCTGTATGCACAGGGATGCCA
GGATCTCTTCCGGTCTTGAATAAGGATGCTGTGCGTAAAGCTGTTTTGTT
CGGCTGCGCTGTAGAGGGGGATGTCGCTTTATTTAGCCGTTTTGATAGAA
AATCCTATTTTTATCCTGACAGCCCAAGAAACTTTCAGATCACCCAATAC
GAGCATCCTATCGTAAGAGGTGGATGTATTCGTGCTGTAGTAGAAGGAGA
AGAGAAAACCTTTGAGCTAGCGCAGACACATCTAGAAGATGATGCGGGGA
TGTTAAAACATTTTGGGGATTTTGCTGGTGTAGACTATAACAGAGCAGGG
GTTCCGTTAATTGAGATTGTTTCCAAGCCTTGTATGTTTAGTGCAGAGGA
TGCTGTTGCATACGCCAATGCTTTGGTATCCATCCTCGGCTACATAGGTA
TTTCCGATTGTAATATGGAAGAAGGTTCTATCCGTTTCGATGTGAATATT
TCTGTTCGCCCTCGAGGAAGTAGGGAGCTTAGAAATAAGGTAGAGATCAA
AAACATGAACTCATTTACCTTTATGGCACAAGCTTTGGAAGCTGAAAAAC
GTCGTCAGATTGAAGAGTATCTTAGCTATCCCAATGAGGATCCAAAAAAA
GTTGTTCCTGCAGCGACTTATCGTTGGGATCCTGAAAAGAAAAAAACGGT
TCTGATGCGTCTCAAGGAACGAGCCGAAGATTATATGTATTTTGTAGAGC
CGGATCTTCCTGTTTTGCAGATCACCGAGACTTATATTGATGAGGTGCGT
CAAACATTACCAGAGCTACCTCATAGTAAATATATGCGTTACATTACAGA
CTTTGATATCGCTGAAGATTTAGCAATGATTCTTGTTGGTGATCGACATA
CGGCTCATTTCTTTGAAACAGCAACTATGTCTTGTAAGAACTATCGTGCT
CTTTCGAATTGGATCACAGTCGAATTTGCGGGCCGTTGTAAAGCTAGAGG
GAAGACGCTGCCATTCACGGGGATTCTTCCTGAATGGGTAGCGCAATTGG
TGAACTTCATAGATCGTGGAGTGATCACAGGGAAAATCGCTAAAGAAATT
GCAGATAGAATGGTCTCTTCTTTTGGGGAAAGCCCAGAAGATATTTTGCG
TAGACATCCTTCGTTGTTACCTATGACGGACGACCATGCGCTACGCGCTA
TCGTTAAAGAGGTGGTTGCTCAAAATACCGCGTCTGTAGCGGATTACAAG
AACGGGAAAGCTAAAGCTTTGGGCTTTTTGGTTGGACAGATCATGAAGCG
AACAGAAGGGAAAGCTCCTCCTAAGCGAGTAAACGAATTGCTATTAGCAG
CTATGCGAGATATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy