Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR3 IGR2 IGR4 IGR5 IGR1 IGR1.1 IGR732 IGR6 CT001 CT006 CT005 pmpI, - CT874 gatC, - CT002 gatB, - CT004 gluA,gatA, - CT003 CT875 CT001 CT006 CT005 pmpI, - CT874 gatC, - CT002 gatB, - CT004 gluA,gatA, - CT003 CT875 CT001 CT006 CT005 pmpI, - CT874 gatC, - CT002 gatB, - CT004 gluA,gatA, - CT003 CT875
* Calculated from Protein Sequence

Gene ID: CT002

DNA Molecule Name:
1  

Genbank ID:
3328390

Gene Name:
gatC  

Definition:
Glu-tRNA Gln amidotransferase C subunit

Gene Start:
1794

Gene Stop:
2093

Gene Length:
300

Molecular Weight*:
11057

pI*:
3.97

Net Charge*:
-14.28

EC:
6.3.5.-  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Jahn D, Kim YC, Ishino Y, Chen MW, Soll D. 1990. Purification and functional characterization of the Glu-tRNA(Gln) amidotransferase from Chlamydomonas reinhardtii. J Biol Chem 265(14):8059-64. Medline: 1970821.

Comment:
This sequence is identical to GenBank accession AAC6759 (genome position accession AE001275). See CT003 and CT004 for the A and B subunits. Possible Glu-tRNA Gln amidotransferase.

Hi there world.

Blast Summary:  PSI-Blast Search
CPn0002 is orthologously related to CT002: residues 1-101 of CPn0002 are 53% similar to residues 1-100 of CT002, a predicted Glu-tRNA Gln amidotransferase C subunit from C.

CT002 shows very low similarity to a glutamyl t-RNA
amidotransferase subunit C: residues 6-100 are 26% similar to the enzyme in Aquifex aeolicus. No similarities toT. pallidum or M. genitalium.


COGS Summary:  COGS Search
BeTs to 7 clades of COG0721
COG name: Glu-tRNAGln amidotransferase C subunit
Functional Class: J
The phylogenetic pattern of COG0721 is amt--qvc-br-ujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 22 to 95 (E-value = 6.7e-31) place CT002 in the Glu-tRNAGln family which is described as Glu-tRNAGln amidotransferase C subunit (PF02686)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
28

PDB Hit:
None.

Gene Protein Sequence:
MTESYVNKEEIISLAKNAALELEDAHVEEFVTSMNDVIALMQEVIAIDIS
DIILEATVHHFVGPEDLREDMVTSDFTQEEFLSNVPVSLGGLVKVPTVIK


Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGAGTCATATGTAAACAAAGAAGAAATCATCTCTTTAGCAAAGAA
TGCTGCATTGGAGTTGGAAGATGCCCACGTGGAAGAGTTCGTAACATCTA
TGAATGACGTCATTGCTTTAATGCAGGAAGTAATCGCGATAGATATTTCG
GATATCATTCTTGAAGCTACAGTGCATCATTTCGTTGGTCCAGAGGATCT
TAGAGAAGACATGGTGACTTCGGATTTTACTCAAGAAGAATTTTTATCTA
ACGTTCCCGTGTCGTTGGGAGGATTAGTCAAAGTCCCTACAGTTATCAAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy